Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase ULK4

Gene

Ulk4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei121 – 1211Proton acceptorPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • cilium morphogenesis Source: MGI
  • corpus callosum development Source: MGI
  • epithelial cilium movement Source: MGI
  • microtubule cytoskeleton organization Source: MGI
  • regulation of JNK cascade Source: MGI
  • regulation of MAPK cascade Source: MGI
  • regulation of neuron migration Source: MGI
  • regulation of neuron projection development Source: MGI
  • regulation of p38MAPK cascade Source: MGI
  • regulation of protein kinase C signaling Source: MGI
  • ventricular system development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase ULK4 (EC:2.7.11.1)
Alternative name(s):
Unc-51-like kinase 4
Gene namesi
Name:Ulk4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1921622. Ulk4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13031303Serine/threonine-protein kinase ULK4PRO_0000250154Add
BLAST

Proteomic databases

MaxQBiQ3V129.
PaxDbiQ3V129.
PRIDEiQ3V129.

PTM databases

PhosphoSiteiQ3V129.

Expressioni

Gene expression databases

BgeeiENSMUSG00000040936.
CleanExiMM_ULK4.
ExpressionAtlasiQ3V129. baseline and differential.
GenevisibleiQ3V129. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131342.

Structurei

3D structure databases

ProteinModelPortaliQ3V129.
SMRiQ3V129. Positions 1-324.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 280277Protein kinasePROSITE-ProRule annotationAdd
BLAST
Repeati504 – 54340HEAT 1Add
BLAST
Repeati727 – 76539HEAT 2Add
BLAST
Repeati796 – 83439HEAT 3Add
BLAST
Repeati926 – 96439HEAT 4Add
BLAST
Repeati1025 – 106339HEAT 5Add
BLAST
Repeati1105 – 114339HEAT 6Add
BLAST
Repeati1151 – 118939HEAT 7Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1147 – 11504Poly-Leu

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.PROSITE-ProRule annotation
Contains 7 HEAT repeats.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0597. Eukaryota.
ENOG410XRQ6. LUCA.
GeneTreeiENSGT00720000108824.
HOGENOMiHOG000007938.
HOVERGENiHBG094135.
InParanoidiQ3V129.
KOiK17545.
PhylomeDBiQ3V129.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 5 hits.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3V129-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENFVLYEEI GRGSRTVVYK GRRKGTINFV AILCTEKCKR PEITNWVRLT
60 70 80 90 100
HEIKHKNIVT FHEWYETSNH LWLVVELCTG GSLETVIAQD ENLPEDVVRE
110 120 130 140 150
FGVDLVTGLH HLHRLGILFC DLSPGKILLE GPGTLKFSNF CLAKVAGESL
160 170 180 190 200
EEFFALVAAE EGGGDSGENA LKKSMKTRVR GSLIYAAPEI VKGTEFSVTS
210 220 230 240 250
DLWSLGCLLY EMFSGKPPFF SETVSELVEK ILYEDPLPPI PKDSSFPKAS
260 270 280 290 300
SDFLNLLDGL LQKDPQKRFS WEGVLQHPFW KDALRGEDSG WASEDSPFSR
310 320 330 340 350
NVMECSGPHD SRELLQSPKN GQAKGQKAAH RLSQSFRLEN PTELRPKSIM
360 370 380 390 400
GGQLNESIFL LSSRPTPRTS AMVELNPGEG EDPSSPQKTS PLSKMTSGHL
410 420 430 440 450
SQGALESQMR ELIYTDSDLV ITPIIDNPKI MKQPAIKFDP KILHLPAYSV
460 470 480 490 500
EKLLVLKDQD WNDFLQQVCS QIDSSEKSTG ALRAKLNLLC YLCVVATHKE
510 520 530 540 550
VATRLLHSPL FQLLIQHLRI APNWDIRSKV ARVVGMLALH TTELQENVPV
560 570 580 590 600
IEAITLLTEL IRENFRSGKL KQCLLPTLGQ LLYLVATQEE KNQHSRDCWA
610 620 630 640 650
VPLAAYTVLM RCLREGEERV VNHMAAKIIE NVCTTFSAQA QGFTTGEIGP
660 670 680 690 700
VLWHLFRHST VDALRITAIS ALCRITRQSP TAFQNVIEKV GLNAVISSLA
710 720 730 740 750
SAICKVQQYM LTLFTAMLSC GIHLQRLIQE KDFVSTVIRL LDSPSTPIRA
760 770 780 790 800
KAFLVLLYIL IHNRDMLLLS CQARLVMYIE RDSRKTSPGK EQQSGNEYLA
810 820 830 840 850
RCLDLLIQHM VQEPPRILGD ILNALANVSG RKHPSTVQGK QLKMCLPMMP
860 870 880 890 900
VVLHLVMSQV FRPQVVTEEF LFSYGTILSH IKSIDLGETN IDGAIGIVAS
910 920 930 940 950
EEFIKVTLSA FEAVIQYPVL LADYRSTVMD YILPPLVSLV QSQNVEWRLF
960 970 980 990 1000
SLRLLSETTT LLVSQEPEDG DEEASCDSDS SLLALIRDEL LPQYEHILME
1010 1020 1030 1040 1050
PDPVPAYALK LLVAMTEHNP AFTRLVEESK LVPLIFEVIL EHQESILGNT
1060 1070 1080 1090 1100
MQSVIALLNN LVAYKDSNMQ LLYEQGLVGH VCNMFTETAT LCLDRDNKTN
1110 1120 1130 1140 1150
TEPASTLLAS LLDILLGMLT YTSRIVRQAL QVQKSGSRGD TQAAEDLLLL
1160 1170 1180 1190 1200
SKPLTDLISL LIPLLPSEDP EISEVSSKCL SILVQLYGGE NPESLSPENM
1210 1220 1230 1240 1250
VTFANLLMTK EDPKDQKLLL RILKRMVTSN ERLLESLKNT GSLLQALERL
1260 1270 1280 1290 1300
APAHRLRGPW AGISCALFQQ RAAAQGIPEL PPYGIPCCGP SHKRVTGVKL

YPC
Length:1,303
Mass (Da):145,342
Last modified:September 19, 2006 - v2
Checksum:iD875519D87A21672
GO
Isoform 2 (identifier: Q3V129-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-530: RSKV → LLYV
     531-1303: Missing.

Note: No experimental confirmation available.
Show »
Length:530
Mass (Da):59,388
Checksum:iD1BB61AFDE3940B9
GO
Isoform 3 (identifier: Q3V129-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     879-910: SHIKSIDLGETNIDGAIGIVASEEFIKVTLSA → VSSRSHVWPAPLPWLQHGCEKGGIERLSGICL
     911-1303: Missing.

Note: No experimental confirmation available.
Show »
Length:910
Mass (Da):101,938
Checksum:iA602520F381A0ECD
GO
Isoform 4 (identifier: Q3V129-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-430: Missing.
     775-835: LVMYIERDSR...ANVSGRKHPS → RHSQRPGKRV...SLQLRNYSCE
     836-1303: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):45,214
Checksum:iB5D9C45ABA693FFB
GO
Isoform 5 (identifier: Q3V129-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1050: Missing.

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):27,756
Checksum:i10B530B39FED6E38
GO
Isoform 6 (identifier: Q3V129-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1165-1185: LPSEDPEISEVSSKCLSILVQ → VRAHLCASAEVQRLKQFYLNF

Note: No experimental confirmation available.
Show »
Length:1,303
Mass (Da):145,563
Checksum:i8184E3D50BECA157
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 10501050Missing in isoform 5. 1 PublicationVSP_020605Add
BLAST
Alternative sequencei1 – 430430Missing in isoform 4. 1 PublicationVSP_020606Add
BLAST
Alternative sequencei527 – 5304RSKV → LLYV in isoform 2. 1 PublicationVSP_020607
Alternative sequencei531 – 1303773Missing in isoform 2. 1 PublicationVSP_020608Add
BLAST
Alternative sequencei775 – 83561LVMYI…RKHPS → RHSQRPGKRVRPEAPIHGPG EAAEDVSPHDACGASSGDVA GISTSSCDRRVSLQLRNYSC E in isoform 4. 1 PublicationVSP_020609Add
BLAST
Alternative sequencei836 – 1303468Missing in isoform 4. 1 PublicationVSP_020610Add
BLAST
Alternative sequencei879 – 91032SHIKS…VTLSA → VSSRSHVWPAPLPWLQHGCE KGGIERLSGICL in isoform 3. 2 PublicationsVSP_020611Add
BLAST
Alternative sequencei911 – 1303393Missing in isoform 3. 2 PublicationsVSP_020612Add
BLAST
Alternative sequencei1165 – 118521LPSED…SILVQ → VRAHLCASAEVQRLKQFYLN F in isoform 6. 1 PublicationVSP_020613Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK016524 mRNA. Translation: BAB30285.1.
AK043477 mRNA. Translation: BAC31554.1.
AK043628 mRNA. Translation: BAC31600.1.
AK132731 mRNA. Translation: BAE21324.1.
BC109364 mRNA. Translation: AAI09365.1.
BC109365 mRNA. Translation: AAI09366.1.
RefSeqiNP_808257.2. NM_177589.3.
UniGeneiMm.371804.

Genome annotation databases

EnsembliENSMUST00000171061; ENSMUSP00000129214; ENSMUSG00000040936. [Q3V129-3]
GeneIDi209012.
KEGGimmu:209012.
UCSCiuc009scz.2. mouse. [Q3V129-3]
uc012hcp.1. mouse. [Q3V129-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK016524 mRNA. Translation: BAB30285.1.
AK043477 mRNA. Translation: BAC31554.1.
AK043628 mRNA. Translation: BAC31600.1.
AK132731 mRNA. Translation: BAE21324.1.
BC109364 mRNA. Translation: AAI09365.1.
BC109365 mRNA. Translation: AAI09366.1.
RefSeqiNP_808257.2. NM_177589.3.
UniGeneiMm.371804.

3D structure databases

ProteinModelPortaliQ3V129.
SMRiQ3V129. Positions 1-324.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131342.

PTM databases

PhosphoSiteiQ3V129.

Proteomic databases

MaxQBiQ3V129.
PaxDbiQ3V129.
PRIDEiQ3V129.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000171061; ENSMUSP00000129214; ENSMUSG00000040936. [Q3V129-3]
GeneIDi209012.
KEGGimmu:209012.
UCSCiuc009scz.2. mouse. [Q3V129-3]
uc012hcp.1. mouse. [Q3V129-4]

Organism-specific databases

CTDi54986.
MGIiMGI:1921622. Ulk4.

Phylogenomic databases

eggNOGiKOG0597. Eukaryota.
ENOG410XRQ6. LUCA.
GeneTreeiENSGT00720000108824.
HOGENOMiHOG000007938.
HOVERGENiHBG094135.
InParanoidiQ3V129.
KOiK17545.
PhylomeDBiQ3V129.

Miscellaneous databases

PROiQ3V129.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040936.
CleanExiMM_ULK4.
ExpressionAtlasiQ3V129. baseline and differential.
GenevisibleiQ3V129. MM.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 5 hits.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiULK4_MOUSE
AccessioniPrimary (citable) accession number: Q3V129
Secondary accession number(s): Q2VP87
, Q32LZ6, Q8BLS0, Q8C8Z5, Q9D4H6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: September 7, 2016
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.