Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein-lysine N-methyltransferase EEF2KMT

Gene

Eef2kmt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the trimethylation of eukaryotic elongation factor 2 (EEF2) on 'Lys-525'.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei139S-adenosyl-L-methionine; via amide nitrogenBy similarity1
Binding sitei228S-adenosyl-L-methionine; via amide nitrogenBy similarity1
Binding sitei247S-adenosyl-L-methionine; via carbonyl oxygenBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Protein-lysine N-methyltransferase EEF2KMTCurated (EC:2.1.1.-By similarity)
Alternative name(s):
eEF2-lysine methyltransferase
Short name:
eEF2-KMT
Gene namesi
Name:Eef2kmt
Synonyms:Fam86, Fam86a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:1917761. Eef2kmt.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000762191 – 335Protein-lysine N-methyltransferase EEF2KMTAdd BLAST335

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ3UZW7.
PaxDbiQ3UZW7.
PRIDEiQ3UZW7.

PTM databases

PhosphoSitePlusiQ3UZW7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000022544.
CleanExiMM_5730409G15RIK.
ExpressionAtlasiQ3UZW7. baseline and differential.
GenevisibleiQ3UZW7. MM.

Interactioni

Subunit structurei

Interacts with FAM86B2 and FAM86C1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068003.

Structurei

3D structure databases

ProteinModelPortaliQ3UZW7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni165 – 167S-adenosyl-L-methionine bindingBy similarity3

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2497. Eukaryota.
ENOG410ZQK4. LUCA.
GeneTreeiENSGT00510000047003.
HOGENOMiHOG000067842.
HOVERGENiHBG059594.
InParanoidiQ3UZW7.
OMAiPVKKMAW.
OrthoDBiEOG091G0E1D.
PhylomeDBiQ3UZW7.
TreeFamiTF326304.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR029426. FAM86.
IPR019410. Methyltransf_16.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF14904. FAM86. 1 hit.
PF10294. Methyltransf_16. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UZW7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPEDHEGAT SLLQSFERRF LAARALPSFP WQSLEEKLKD PSGSELLLAI
60 70 80 90 100
LQRTVKHPVC VQHGPSVKYA RCFLSKLIKK HEAVPTEPLD ALYEALAEVL
110 120 130 140 150
MTQESTQCHR SYLLPSGNSV TLSESTAIVS HGTTGLVTWD AALYLAEWAI
160 170 180 190 200
ENPAAFTDRT ILELGSGAGL TGLAICKACC PRAYIFSDCH AQVLEQLRGN
210 220 230 240 250
VLLNGFSLEP HTPIDAGSSK VTVAQLDWDE VTASQLSAFQ ADVVIAADVL
260 270 280 290 300
YCWEMTLSLV RVLKMLEDCQ RKSAPDVYVA YTIRSQDTGK LFIEELDRAG
310 320 330
IYWEEVPPHT GKLFPYEEHS AIVILKLVLT SRHGV
Length:335
Mass (Da):36,940
Last modified:October 11, 2005 - v1
Checksum:i8CEF3DF903359520
GO
Isoform 2 (identifier: Q3UZW7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.

Note: No experimental confirmation available.
Show »
Length:235
Mass (Da):25,764
Checksum:i773816C0F219F5FE
GO
Isoform 3 (identifier: Q3UZW7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-335: DRAGIYWEEVPPHTGKLFPYEEHSAIVILKLVLTSRHGV → GQFPTCGPPFCHEEGLKTGLTLR

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):34,970
Checksum:iFAC12FA78EB585C1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti3P → R in BAE37370 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0333291 – 100Missing in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_033330297 – 335DRAGI…SRHGV → GQFPTCGPPFCHEEGLKTGL TLR in isoform 3. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK017533 mRNA. Translation: BAB30795.3.
AK133590 mRNA. Translation: BAE21738.1.
AK163493 mRNA. Translation: BAE37370.1.
AC124576 Genomic DNA. No translation available.
BC051078 mRNA. Translation: AAH51078.1.
CCDSiCCDS27935.1. [Q3UZW7-1]
RefSeqiNP_081722.1. NM_027446.2. [Q3UZW7-1]
UniGeneiMm.45780.

Genome annotation databases

EnsembliENSMUST00000064635; ENSMUSP00000068003; ENSMUSG00000022544. [Q3UZW7-1]
GeneIDi70511.
KEGGimmu:70511.
UCSCiuc007ybz.1. mouse. [Q3UZW7-1]
uc007yca.1. mouse. [Q3UZW7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK017533 mRNA. Translation: BAB30795.3.
AK133590 mRNA. Translation: BAE21738.1.
AK163493 mRNA. Translation: BAE37370.1.
AC124576 Genomic DNA. No translation available.
BC051078 mRNA. Translation: AAH51078.1.
CCDSiCCDS27935.1. [Q3UZW7-1]
RefSeqiNP_081722.1. NM_027446.2. [Q3UZW7-1]
UniGeneiMm.45780.

3D structure databases

ProteinModelPortaliQ3UZW7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068003.

PTM databases

PhosphoSitePlusiQ3UZW7.

Proteomic databases

EPDiQ3UZW7.
PaxDbiQ3UZW7.
PRIDEiQ3UZW7.

Protocols and materials databases

DNASUi70511.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064635; ENSMUSP00000068003; ENSMUSG00000022544. [Q3UZW7-1]
GeneIDi70511.
KEGGimmu:70511.
UCSCiuc007ybz.1. mouse. [Q3UZW7-1]
uc007yca.1. mouse. [Q3UZW7-3]

Organism-specific databases

CTDi196483.
MGIiMGI:1917761. Eef2kmt.

Phylogenomic databases

eggNOGiKOG2497. Eukaryota.
ENOG410ZQK4. LUCA.
GeneTreeiENSGT00510000047003.
HOGENOMiHOG000067842.
HOVERGENiHBG059594.
InParanoidiQ3UZW7.
OMAiPVKKMAW.
OrthoDBiEOG091G0E1D.
PhylomeDBiQ3UZW7.
TreeFamiTF326304.

Miscellaneous databases

PROiQ3UZW7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022544.
CleanExiMM_5730409G15RIK.
ExpressionAtlasiQ3UZW7. baseline and differential.
GenevisibleiQ3UZW7. MM.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR029426. FAM86.
IPR019410. Methyltransf_16.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF14904. FAM86. 1 hit.
PF10294. Methyltransf_16. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiEF2KT_MOUSE
AccessioniPrimary (citable) accession number: Q3UZW7
Secondary accession number(s): Q3TQL2, Q80XE2, Q9CS89
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: October 11, 2005
Last modified: November 2, 2016
This is version 82 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.