Q3UZ39 (LRRF1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Leucine-rich repeat flightless-interacting protein 1 Short name=LRR FLII-interacting protein 1 Alternative name(s): FLI-LRR-associated protein 1 Short name=Flap-1 H186 FLAP | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 729 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA By similarity. Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding By similarity. |
| Subunit structure | Interacts with FLII. Interacts with MYD88 By similarity. Competes with FLII for MyD88-binding, even in the absence of LPS By similarity. Ref.1 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Sequence similarities | Belongs to the LRRFIP family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | DNA-binding |
| Molecular function | Repressor |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| chBcat | O42486 | 2 | EBI-2270972,EBI-972394 | From a different organism. |
| Grip1 | Q925T6 | 2 | EBI-2270972,EBI-537752 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3UZ39-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q3UZ39-2) The sequence of this isoform differs from the canonical sequence as follows: 51-51: E → EIYQVQKKYY...RASSARASPV 104-104: I → IKELNELKDQIQDVEGKYMQGLKEM 193-193: E → EEIRQLQQKQAGFIREISDLQETIEWKDKKIGALERQKEFFDSIRSERDDLREETVKLKEELK 241-394: GKAKEVEVKK...ILGQTAEIDK → DVRLKKLIDE...ANRSALLSQQ 395-729: Missing. | ||||||
| Isoform 3 (identifier: Q3UZ39-3) The sequence of this isoform differs from the canonical sequence as follows: 1-239: Missing. 240-240: L → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 729 | 728 | Leucine-rich repeat flightless-interacting protein 1 | PRO_0000248393 | |||||
Regions | |||||||||
| Region | 465 – 567 | 103 | DNA-binding By similarity | ||||||
| Coiled coil | 94 – 194 | 101 | Potential | ||||||
| Compositional bias | 530 – 563 | 34 | Lys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylthreonine By similarity | ||||||
| Modified residue | 16 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 83 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 88 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 91 | 1 | Phosphothreonine Ref.3 | ||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 538 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 239 | 239 | Missing in isoform 3. | VSP_020266 | |||||
| Alternative sequence | 51 | 1 | E → EIYQVQKKYYGLDTKWGDIE QWMEDSERYSRRFRRNTSAS DEDERLSVGSRGSLRTNGYD GDYCGSQSLSRRSGRGLSCS NLGLPSSGLASKPLSTQNGS RASMLDESSLYGARRGSACG SRAPSEYGSHLNSSSRASSR ASSARASPV in isoform 2. | VSP_020267 | |||||
| Alternative sequence | 104 | 1 | I → IKELNELKDQIQDVEGKYMQ GLKEM in isoform 2. | VSP_020268 | |||||
| Alternative sequence | 193 | 1 | E → EEIRQLQQKQAGFIREISDL QETIEWKDKKIGALERQKEF FDSIRSERDDLREETVKLKE ELK in isoform 2. | VSP_020269 | |||||
| Alternative sequence | 240 | 1 | L → M in isoform 3. | VSP_020270 | |||||
| Alternative sequence | 241 – 394 | 154 | GKAKE…AEIDK → DVRLKKLIDERECLLEQIKK LKGQLEGRQKNNKLDLLRAE DGILENGTDAHVMDLQRDAN RQISDLKFKLAKSEQEITAL EQNVIRLESQVTRYRSAAEN AEKIEDELKAEKRKLQRELR SALDKTEELEVSNGHLVKRL EKMKANRSALLSQQ in isoform 2. | VSP_020271 | |||||
| Alternative sequence | 395 – 729 | 335 | Missing in isoform 2. | VSP_020272 | |||||
Experimental info | |||||||||
| Sequence conflict | 122 | 1 | N → K in BAE22022. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of the binding partners for flightless I, a novel protein bridging the leucine-rich repeat and the gelsolin superfamilies." Liu Y.-T., Yin H.L. J. Biol. Chem. 273:7920-7927(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH FLII, TISSUE SPECIFICITY. Tissue: Skeletal muscle. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: C57BL/6J. Tissue: Egg and Thymus. |
| [3] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-91, MASS SPECTROMETRY. Tissue: Liver. |
| [4] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-88 AND SER-302, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF045573 mRNA. Translation: AAC40072.1. AK134120 mRNA. Translation: BAE22022.1. AK162191 mRNA. Translation: BAE36781.1. |
| IPI | IPI00117277. IPI00654388. IPI00785324. |
| RefSeq | NP_001104781.1. NM_001111311.1. NP_001104782.1. NM_001111312.1. NP_032541.1. NM_008515.4. |
| UniGene | Mm.395990. Mm.45039. |
3D structure databases | |
| ProteinModelPortal | Q3UZ39. |
| SMR | Q3UZ39. Positions 111-193. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q3UZ39. 3 interactions. |
PTM databases | |
| PhosphoSite | Q3UZ39. |
Proteomic databases | |
| PaxDb | Q3UZ39. |
| PRIDE | Q3UZ39. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000097649; ENSMUSP00000095254; ENSMUSG00000026305. ENSMUST00000097650; ENSMUSP00000095255; ENSMUSG00000026305. |
| GeneID | 16978. |
| KEGG | mmu:16978. |
| UCSC | uc007bzr.2. mouse. uc007bzs.2. mouse. uc007bzu.2. mouse. |
Organism-specific databases | |
| CTD | 9208. |
| MGI | MGI:1342770. Lrrfip1. |
Phylogenomic databases | |
| eggNOG | NOG296572. |
| GeneTree | ENSGT00530000063564. |
| HOGENOM | HOG000294125. |
| HOVERGEN | HBG081935. |
| InParanoid | Q3UZ39. |
| OMA | AREEVGN. |
| OrthoDB | EOG4J9N06. |
Gene expression databases | |
| ArrayExpress | Q3UZ39. |
| Bgee | Q3UZ39. |
| Genevestigator | Q3UZ39. |
| GermOnline | ENSMUSG00000026305. Mus musculus. |
Family and domain databases | |
| InterPro | IPR019139. Leu-rich_rep_flightless-int_pr. [Graphical view] |
| PANTHER | PTHR19212. PTHR19212. 1 hit. |
| Pfam | PF09738. DUF2051. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 291052. |
| SOURCE | Search... |
Entry information
| Entry name | LRRF1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3UZ39 Secondary accession number(s): O70323, Q3TS94 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
