Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell receptor-associated transmembrane adapter 1

Gene

Trat1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell receptor-associated transmembrane adapter 1
Alternative name(s):
T-cell receptor-interacting molecule
Short name:
TRIM
Gene namesi
Name:Trat1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1924897. Trat1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 77ExtracellularSequence analysis
Transmembranei8 – 2821Helical; Signal-anchor for type III membrane proteinSequence analysisAdd
BLAST
Topological domaini29 – 187159CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 187187T-cell receptor-associated transmembrane adapter 1PRO_0000083345Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi7 – 7InterchainBy similarity
Modified residuei46 – 461PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated on tyrosines upon TCR activation.By similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

EPDiQ3UU67.
PaxDbiQ3UU67.
PRIDEiQ3UU67.

PTM databases

PhosphoSiteiQ3UU67.

Expressioni

Tissue specificityi

Present in T-cells (at protein level).1 Publication

Developmental stagei

Present in thymocytes from E16.5 (at protein level).1 Publication

Gene expression databases

BgeeiQ3UU67.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Interacts with CD3Z. When phosphorylated, interacts with PIK3R1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000129808.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni80 – 834Interaction with PIK3R1By similarity

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IW4V. Eukaryota.
ENOG410ZB8K. LUCA.
HOGENOMiHOG000129918.
HOVERGENiHBG083932.
InParanoidiQ3UU67.
OrthoDBiEOG7N8ZX9.
PhylomeDBiQ3UU67.
TreeFamiTF336066.

Family and domain databases

InterProiIPR020399. T-cell_rcpt-assoc_TM_adapter-1.
[Graphical view]
PANTHERiPTHR15951. PTHR15951. 1 hit.
ProDomiPD306446. T-cell_rcpt-assoc_TM_adapter-1. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UU67-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGSSGCPFF LWGLLAFLGL ALVISLIFNI SHYVEKQRRD EIYRYSDDYI
60 70 80 90 100
PRVDEYYVED APIYGNLENI IPEPLDENCY EQMKGRPQRS ASDPQEVAAP
110 120 130 140 150
AQVPAEAQMC YASLDHSVKG KRRRPRKQNT NVSDRGKDTQ VYTMDANVSQ
160 170 180
INMVESFPPD NQVVEESIHD DPARLFGLIR AKREPVI
Length:187
Mass (Da):21,330
Last modified:December 20, 2005 - v2
Checksum:i0FE50E7DED590647
GO
Isoform 2 (identifier: Q3UU67-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     19-51: GLALVISLIFNISHYVEKQRRDEIYRYSDDYIP → MPLLPLGTSSLLGLGSGYIVDLQYFPLCREAET

Show »
Length:169
Mass (Da):18,982
Checksum:i8CAE87C5CE19EF77
GO
Isoform 3 (identifier: Q3UU67-3) [UniParc]FASTAAdd to basket

Also known as: DeltaTM-TRIM

The sequence of this isoform differs from the canonical sequence as follows:
     3-39: Missing.

Note: Strongly expressed at E13.5, then down-regulated. Marginal in adult. Protein may be unstable.
Show »
Length:150
Mass (Da):17,194
Checksum:i8AB36B976F9F4DCC
GO

Sequence cautioni

The sequence AAI04352.2 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818Missing in isoform 2. 1 PublicationVSP_016638Add
BLAST
Alternative sequencei3 – 3937Missing in isoform 3. 1 PublicationVSP_016639Add
BLAST
Alternative sequencei19 – 5133GLALV…DDYIP → MPLLPLGTSSLLGLGSGYIV DLQYFPLCREAET in isoform 2. 1 PublicationVSP_016640Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK138735 mRNA. Translation: BAE23761.1.
BC104350 mRNA. Translation: AAI04351.1.
BC104351 mRNA. Translation: AAI04352.2. Different initiation.
RefSeqiNP_938039.2. NM_198297.3.
XP_006522795.1. XM_006522732.2. [Q3UU67-2]
UniGeneiMm.167298.

Genome annotation databases

GeneIDi77647.
KEGGimmu:77647.
UCSCiuc007zjr.1. mouse. [Q3UU67-1]
uc007zjs.1. mouse. [Q3UU67-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK138735 mRNA. Translation: BAE23761.1.
BC104350 mRNA. Translation: AAI04351.1.
BC104351 mRNA. Translation: AAI04352.2. Different initiation.
RefSeqiNP_938039.2. NM_198297.3.
XP_006522795.1. XM_006522732.2. [Q3UU67-2]
UniGeneiMm.167298.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000129808.

PTM databases

PhosphoSiteiQ3UU67.

Proteomic databases

EPDiQ3UU67.
PaxDbiQ3UU67.
PRIDEiQ3UU67.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi77647.
KEGGimmu:77647.
UCSCiuc007zjr.1. mouse. [Q3UU67-1]
uc007zjs.1. mouse. [Q3UU67-2]

Organism-specific databases

CTDi50852.
MGIiMGI:1924897. Trat1.

Phylogenomic databases

eggNOGiENOG410IW4V. Eukaryota.
ENOG410ZB8K. LUCA.
HOGENOMiHOG000129918.
HOVERGENiHBG083932.
InParanoidiQ3UU67.
OrthoDBiEOG7N8ZX9.
PhylomeDBiQ3UU67.
TreeFamiTF336066.

Miscellaneous databases

NextBioi347298.
PROiQ3UU67.
SOURCEiSearch...

Gene expression databases

BgeeiQ3UU67.

Family and domain databases

InterProiIPR020399. T-cell_rcpt-assoc_TM_adapter-1.
[Graphical view]
PANTHERiPTHR15951. PTHR15951. 1 hit.
ProDomiPD306446. T-cell_rcpt-assoc_TM_adapter-1. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Developmentally regulated expression of the transmembrane adaptor protein TRIM in fetal and adult T cells."
    Huynh T., Wuerch A., Bruyns E., Korinek V., Schraven B., Eichmann K.
    Scand. J. Immunol. 54:146-154(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-46, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Lung.

Entry informationi

Entry nameiTRAT1_MOUSE
AccessioniPrimary (citable) accession number: Q3UU67
Secondary accession number(s): Q3SXD9, Q3SXE0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: December 20, 2005
Last modified: March 16, 2016
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.