Q3UTJ2 (SRBS2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sorbin and SH3 domain-containing protein 2 Alternative name(s): Arg/Abl-interacting protein 2 Short name=ArgBP2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1180 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1 By similarity. |
| Subunit structure | Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, WASF, ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1 By similarity. |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Cytoplasm › myofibril › sarcomere › Z line By similarity. Cell junction › focal adhesion By similarity. Cytoplasm › cytoskeleton By similarity. Note: Found at the Z line sarcomeres, stress fibers, dense bodies and focal adhesion By similarity. |
| Post-translational modification | Ubiquitinated by CBL By similarity. |
| Sequence similarities | Contains 3 SH3 domains. Contains 1 SoHo domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat SH3 domain |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | Z disc Inferred from electronic annotation. Source: UniProtKB-SubCell cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell focal adhesionInferred from electronic annotation. Source: UniProtKB-SubCell perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from direct assay PubMed 21689717. Source: MGI |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3UTJ2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q3UTJ2-2) The sequence of this isoform differs from the canonical sequence as follows: 211-211: P → PDEDTDMYNTPYTYNA 308-308: P → PPPLPPTPTP...QDHSSGVSNE | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 353. Contains a phosphoserine at position 355. | ||||||
| Isoform 3 (identifier: Q3UTJ2-3) The sequence of this isoform differs from the canonical sequence as follows: 4-34: Missing. 211-211: P → PDEDTDMYNTPYTYNA 388-914: Missing. 1126-1180: FQALYNYTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → LQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q3UTJ2-4) The sequence of this isoform differs from the canonical sequence as follows: 4-34: Missing. 388-914: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q3UTJ2-5) The sequence of this isoform differs from the canonical sequence as follows: 45-67: Missing. 211-211: P → PDEDTDMYNTPYTYNA 308-308: P → PPPLPPTPTPVPREPSRKPLSVSPSTDGLRSPSPPPRSCVPAPCPSAPDLSPTRPPKKALDYVQDHSSGVSNE 388-914: Missing. 1126-1135: Missing. | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 322. Contains a phosphoserine at position 330. Contains a phosphoserine at position 332. Contains a phosphoserine at position 350. | ||||||
| Isoform 6 (identifier: Q3UTJ2-6) The sequence of this isoform differs from the canonical sequence as follows: 45-67: Missing. 211-211: P → PDEDTDMYNTPYTYNA 309-316: VSIYQSSI → RSVSSRPL 317-1180: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q3UTJ2-7) The sequence of this isoform differs from the canonical sequence as follows: 311-313: IYQ → PCH 314-1180: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1180 | 1180 | Sorbin and SH3 domain-containing protein 2 | PRO_0000344478 | |||||
Regions | |||||||||
| Domain | 166 – 230 | 65 | SoHo | ||||||
| Domain | 943 – 1002 | 60 | SH3 1 | ||||||
| Domain | 1018 – 1079 | 62 | SH3 2 | ||||||
| Domain | 1121 – 1180 | 60 | SH3 3 | ||||||
| Compositional bias | 720 – 731 | 12 | His-rich | ||||||
| Compositional bias | 1011 – 1014 | 4 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 27 | 1 | Phosphoserine Ref.5 Ref.7 | ||||||
| Modified residue | 40 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 130 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 239 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 339 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 357 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 358 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 378 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 379 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 381 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 382 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 451 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 456 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 829 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 1097 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1098 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 4 – 34 | 31 | Missing in isoform 3 and isoform 4. | VSP_034800 | |||||
| Alternative sequence | 45 – 67 | 23 | Missing in isoform 5 and isoform 6. | VSP_034801 | |||||
| Alternative sequence | 211 | 1 | P → PDEDTDMYNTPYTYNA in isoform 2, isoform 3, isoform 5 and isoform 6. | VSP_034802 | |||||
| Alternative sequence | 308 | 1 | P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPRPSAPDLSPTRTGRINP ADIDLENEPWYKFFSELEFG HPPPKKALDYVQDHSSGVSN E in isoform 2. | VSP_034803 | |||||
| Alternative sequence | 308 | 1 | P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPCPSAPDLSPTRPPKKAL DYVQDHSSGVSNE in isoform 5. | VSP_034804 | |||||
| Alternative sequence | 309 – 316 | 8 | VSIYQSSI → RSVSSRPL in isoform 6. | VSP_034805 | |||||
| Alternative sequence | 311 – 313 | 3 | IYQ → PCH in isoform 7. | VSP_034806 | |||||
| Alternative sequence | 314 – 1180 | 867 | Missing in isoform 7. | VSP_034807 | |||||
| Alternative sequence | 317 – 1180 | 864 | Missing in isoform 6. | VSP_034808 | |||||
| Alternative sequence | 388 – 914 | 527 | Missing in isoform 3, isoform 4 and isoform 5. | VSP_034809 | |||||
| Alternative sequence | 1126 – 1180 | 55 | FQALY…YVKRL → LQ in isoform 3. | VSP_034810 | |||||
| Alternative sequence | 1126 – 1135 | 10 | Missing in isoform 5. | VSP_034811 | |||||
Experimental info | |||||||||
| Sequence conflict | 249 | 1 | V → A in AAH39163. Ref.2 | ||||||
| Sequence conflict | 944 | 1 | E → EV in BAE24407. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-532 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 229-313 (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1097-1180 (ISOFORM 5). Strain: C57BL/6J. Tissue: Aorta, Brain cortex, Cerebellum, Embryoid bodies and Vein. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Strain: Czech II. Tissue: Mammary tumor. |
| [3] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 162-1180 (ISOFORM 2). Tissue: Brain. |
| [4] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-829, MASS SPECTROMETRY. Tissue: Brain. |
| [5] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27; THR-451 AND SER-456. Tissue: Brain cortex. |
| [6] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-130; SER-358; SER-378; SER-379; SER-382; SER-1097 AND SER-1098, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis." Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H. J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27, MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239 AND SER-339, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK041051 mRNA. Translation: BAC30799.1. AK049030 mRNA. Translation: BAC33518.1. AK079130 mRNA. Translation: BAC37554.1. AK083429 mRNA. Translation: BAC38913.1. AK139388 mRNA. Translation: BAE23988.1. AK140498 mRNA. Translation: BAE24407.1. BC039163 mRNA. Translation: AAH39163.1. AK122369 mRNA. Translation: BAC65651.1. |
| IPI | IPI00405462. IPI00673886. IPI00900398. IPI00900438. IPI00900461. IPI00900464. IPI00923680. |
| UniGene | Mm.211096. Mm.441720. Mm.447653. |
3D structure databases | |
| ProteinModelPortal | Q3UTJ2. |
| SMR | Q3UTJ2. Positions 927-1180. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q3UTJ2. |
| PRIDE | Q3UTJ2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000125295; ENSMUSP00000116768; ENSMUSG00000031626. ENSMUST00000134675; ENSMUSP00000118160; ENSMUSG00000031626. ENSMUST00000138049; ENSMUSP00000123503; ENSMUSG00000031626. ENSMUST00000139869; ENSMUSP00000121235; ENSMUSG00000031626. ENSMUST00000141039; ENSMUSP00000117544; ENSMUSG00000031626. ENSMUST00000153798; ENSMUSP00000118353; ENSMUSG00000031626. |
| UCSC | uc009lpb.1. mouse. uc009lpc.1. mouse. uc009lpd.1. mouse. uc009lpf.1. mouse. uc009lpi.1. mouse. |
Organism-specific databases | |
| MGI | MGI:1924574. Sorbs2. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG256936. |
| GeneTree | ENSGT00690000102104. |
| HOVERGEN | HBG108509. |
Gene expression databases | |
| ArrayExpress | Q3UTJ2. |
| Bgee | Q3UTJ2. |
| Genevestigator | Q3UTJ2. |
Family and domain databases | |
| InterPro | IPR000108. p67phox. IPR011511. SH3_2. IPR001452. SH3_domain. IPR003127. Sorb. IPR007087. Znf_C2H2. [Graphical view] |
| Pfam | PF00018. SH3_1. 2 hits. PF07653. SH3_2. 1 hit. PF02208. Sorb. 1 hit. [Graphical view] |
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. |
| SMART | SM00326. SH3. 3 hits. SM00459. Sorb. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 3 hits. |
| PROSITE | PS50002. SH3. 3 hits. PS50831. SOHO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 13857343. |
| SOURCE | Search... |
Entry information
| Entry name | SRBS2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3UTJ2 Secondary accession number(s): Q3USC6 Q8CHU0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
