Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorbin and SH3 domain-containing protein 2

Gene

Sorbs2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1 (By similarity). May play a role in the regulation of pancreatic cell adhesion, possibly by acting on WASF1 phosphorylation, enhancing phosphorylation by ABL1, as well as dephosphorylation by PTPN12 (By similarity).By similarity

GO - Molecular functioni

  • metal ion binding Source: InterPro
  • poly(A) RNA binding Source: MGI
  • protein domain specific binding Source: MGI

GO - Biological processi

  • actin filament organization Source: InterPro
  • cell adhesion Source: InterPro
  • cell migration Source: InterPro
  • Notch signaling pathway Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg-binding protein 2
Short name:
ArgBP2
Arg/Abl-interacting protein 2
Gene namesi
Name:Sorbs2
Synonyms:Argbp2, Kiaa0777
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1924574. Sorbs2.

Subcellular locationi

  • Cytoplasmperinuclear region By similarity
  • CytoplasmmyofibrilsarcomereZ line By similarity
  • Apical cell membrane By similarity
  • Cell junctionfocal adhesion By similarity
  • Cell projectionlamellipodium By similarity
  • Cytoplasmcytoskeleton By similarity

  • Note: Found at the Z line sarcomeres, stress fibers, dense bodies and focal adhesion. In pancreatic acinar cells, localized preferentially to the apical membrane. Colocalized with vinculin and filamentous actin at focal adhesions and lamellipodia of pancreatic cells.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11801180Sorbin and SH3 domain-containing protein 2PRO_0000344478Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei27 – 271PhosphoserineCombined sources
Modified residuei28 – 281PhosphoserineCombined sources
Modified residuei40 – 401PhosphoserineBy similarity
Modified residuei130 – 1301PhosphoserineCombined sources
Modified residuei143 – 1431PhosphoserineCombined sources
Modified residuei239 – 2391PhosphoserineCombined sources
Modified residuei319 – 3191PhosphoserineCombined sources
Modified residuei325 – 3251PhosphoserineCombined sources
Modified residuei328 – 3281PhosphoserineCombined sources
Modified residuei339 – 3391PhosphoserineCombined sources
Modified residuei357 – 3571PhosphothreonineBy similarity
Modified residuei367 – 3671PhosphoserineBy similarity
Modified residuei372 – 3721PhosphothreonineBy similarity
Modified residuei377 – 3771PhosphoserineCombined sources
Modified residuei378 – 3781PhosphoserineCombined sources
Modified residuei379 – 3791PhosphoserineCombined sources
Modified residuei381 – 3811PhosphoserineCombined sources
Modified residuei382 – 3821PhosphoserineCombined sources
Modified residuei384 – 3841PhosphoserineBy similarity
Modified residuei463 – 4631PhosphoserineCombined sources
Modified residuei574 – 5741PhosphoserineBy similarity
Modified residuei577 – 5771PhosphoserineCombined sources
Modified residuei630 – 6301PhosphoserineCombined sources
Modified residuei633 – 6331PhosphoserineCombined sources
Modified residuei829 – 8291PhosphoserineCombined sources
Modified residuei923 – 9231PhosphoserineCombined sources
Modified residuei1097 – 10971PhosphoserineCombined sources
Isoform 5 (identifier: Q3UTJ2-5)
Modified residuei322 – 3221PhosphoserineCombined sources
Modified residuei324 – 3241PhosphoserineCombined sources
Modified residuei330 – 3301PhosphoserineCombined sources
Modified residuei332 – 3321PhosphoserineCombined sources
Isoform 2 (identifier: Q3UTJ2-2)
Modified residuei345 – 3451PhosphoserineCombined sources
Modified residuei347 – 3471PhosphoserineCombined sources
Modified residuei353 – 3531PhosphoserineCombined sources
Modified residuei355 – 3551PhosphoserineCombined sources
Modified residuei368 – 3681PhosphoserineCombined sources
Modified residuei373 – 3731PhosphoserineCombined sources

Post-translational modificationi

Ubiquitinated by CBL.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ3UTJ2.
PaxDbiQ3UTJ2.
PeptideAtlasiQ3UTJ2.
PRIDEiQ3UTJ2.

PTM databases

iPTMnetiQ3UTJ2.
PhosphoSiteiQ3UTJ2.

Expressioni

Gene expression databases

BgeeiENSMUSG00000031626.
ExpressionAtlasiQ3UTJ2. baseline and differential.
GenevisibleiQ3UTJ2. MM.

Interactioni

Subunit structurei

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, WASF, ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1. Interacts with PTPN12 and WASF1 via its SH3 domains; this interaction may mediate the partial PTPN12 and WASF1 translocation to focal adhesion sites.By similarity

GO - Molecular functioni

  • protein domain specific binding Source: MGI

Protein-protein interaction databases

BioGridi231503. 8 interactions.
IntActiQ3UTJ2. 4 interactions.
MINTiMINT-1853612.
STRINGi10090.ENSMUSP00000128000.

Structurei

3D structure databases

ProteinModelPortaliQ3UTJ2.
SMRiQ3UTJ2. Positions 944-1180.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini166 – 23065SoHoPROSITE-ProRule annotationAdd
BLAST
Domaini943 – 100260SH3 1PROSITE-ProRule annotationAdd
BLAST
Domaini1018 – 107962SH3 2PROSITE-ProRule annotationAdd
BLAST
Domaini1121 – 118060SH3 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi720 – 73112His-richAdd
BLAST
Compositional biasi1011 – 10144Poly-Pro

Domaini

The first 2 SH3 domains are required for WASF1-binding. All 3 SH3 domains can bind independently to PTPN12.By similarity

Sequence similaritiesi

Contains 3 SH3 domains.PROSITE-ProRule annotation
Contains 1 SoHo domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiENOG410KCZT. Eukaryota.
ENOG410XNVJ. LUCA.
GeneTreeiENSGT00760000119190.
HOVERGENiHBG108509.
InParanoidiQ3UTJ2.

Family and domain databases

InterProiIPR028516. ArgBP2.
IPR001452. SH3_domain.
IPR003127. SoHo_dom.
IPR007087. Znf_C2H2.
[Graphical view]
PANTHERiPTHR10663:SF207. PTHR10663:SF207. 1 hit.
PfamiPF00018. SH3_1. 2 hits.
PF14604. SH3_9. 1 hit.
PF02208. Sorb. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 3 hits.
SM00459. Sorb. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 3 hits.
PROSITEiPS50002. SH3. 3 hits.
PS50831. SOHO. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UTJ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNTDSGGCAR KRAAMSVTLT SVKRVQSSPN LLAAGRESQS PDSAWRSYND
60 70 80 90 100
RNPETLNGDA TYSSLAAKGF RSVRPNLQDK RSPTQSQITI NGNSGGAVSP
110 120 130 140 150
VSYYQRPFSP SAYSLPASLN SSIIMQHGRS LDSAETYSQH AQSLDGTMGS
160 170 180 190 200
SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT
210 220 230 240 250
MFKQIHMVHK PGLYNSPYSA QSHPAAKTQT YRPLSKSHSD NGTDAFKEVP
260 270 280 290 300
SPVPPPHVPP RPRDQSSTLK HDWDPPDRKV DTRKFRSEPR SIFEYEPGKS
310 320 330 340 350
SILQHERPVS IYQSSIDRSL ERPSSSASMA GDFRKRRKSE PAVGPLRGLG
360 370 380 390 400
DQSSSRTSPG RADLPGSSST FTKSFISSSP SSPSRAQGGD DSKMCPPLCS
410 420 430 440 450
YSGLNGTPSG ELECCNAYRQ HLDVPGDSQR AITFKNGWQM ARQNAEIWSS
460 470 480 490 500
TEETVSPKIK SRSCDDLLND DCDSFPDPKT KSESMGSLLC EEDSKESCPM
510 520 530 540 550
TWASPYIQEV CGNSRSRLKH RSAHNAPGFL KMYKKMHRIN RKDLMNSEVI
560 570 580 590 600
CSVKSRILQY EKEQQHRGLL HGWSQSSTEE VPRDVVPTRI SEFEKLIQKS
610 620 630 640 650
KSMPNLGDEM LSPITLEPPQ NGLCPKRRFS IESLLEEETQ VRHPSQGQRS
660 670 680 690 700
CKSNTLVPIH IEVTSDEQPR THMEFSDSDQ DGVVSDHSDY VHVEGSSFCS
710 720 730 740 750
ESDFDHFSFT SSESFYGSSH HHHHHHHHHR HLISSCKGRC PASYTRFTTM
760 770 780 790 800
LKHERAKHEN MDRPRRQEMD PGLSKLAFLV SPVPFRRKKI LTPQKQTEKA
810 820 830 840 850
KCKASVVEAL DSALKDICDQ IKAEKRRGSL PDNSILHRLI SELLPQIPER
860 870 880 890 900
NSSLHALKRS PMHQPFHPLP PDGASHCPLY QNDCGRMPHS ASFPDVDTTS
910 920 930 940 950
NYHAQDYGSA LSLQDHESPR SYSSTLTDLG RSASRERRGT PEKEKLPAKA
960 970 980 990 1000
VYDFKAQTSK ELSFKKGDTV YILRKIDQNW YEGEHHGRVG IFPISYVEKL
1010 1020 1030 1040 1050
TPPEKAQPAR PPPPVQPGEI GEAIAKYNFN ADTNVELSLR KGDRIILLKR
1060 1070 1080 1090 1100
VDQNWYEGKI PGTNRQGIFP VSYVEVVKRN AKGAEDYPDP PLPHSYSSDR
1110 1120 1130 1140 1150
IYTLSSNKPQ RPGFSHENIQ GGGEPFQALY NYTPRNEDEL ELRESDVVDV
1160 1170 1180
MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL
Note: No experimental confirmation available.
Length:1,180
Mass (Da):132,349
Last modified:July 22, 2008 - v2
Checksum:i99ECA798E95A092E
GO
Isoform 2 (identifier: Q3UTJ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-211: P → PDEDTDMYNTPYTYNA
     308-308: P → PPPLPPTPTP...QDHSSGVSNE

Note: No experimental confirmation available.Combined sources
Show »
Length:1,295
Mass (Da):145,012
Checksum:i05E03BF51F0D0FE4
GO
Isoform 3 (identifier: Q3UTJ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-34: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     388-914: Missing.
     1126-1180: FQALYNYTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → LQ

Note: No experimental confirmation available.
Show »
Length:584
Mass (Da):64,990
Checksum:i2E93E14021A5F1AE
GO
Isoform 4 (identifier: Q3UTJ2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-34: Missing.
     388-914: Missing.

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):69,477
Checksum:i63298ED47475B3F1
GO
Isoform 5 (identifier: Q3UTJ2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-67: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     308-308: P → PPPLPPTPTPVPREPSRKPLSVSPSTDGLRSPSPPPRSCVPAPCPSAPDLSPTRPPKKALDYVQDHSSGVSNE
     388-914: Missing.
     1126-1135: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:707
Mass (Da):78,102
Checksum:i726FB101E2D1A269
GO
Isoform 6 (identifier: Q3UTJ2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-67: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     309-316: VSIYQSSI → RSVSSRPL
     317-1180: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):34,144
Checksum:iEFC3C49B080C2BDB
GO
Isoform 7 (identifier: Q3UTJ2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-313: IYQ → PCH
     314-1180: Missing.

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):34,573
Checksum:i403BEF28C731B333
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti249 – 2491V → A in AAH39163 (PubMed:15489334).Curated
Sequence conflicti944 – 9441E → EV in BAE24407 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei4 – 3431Missing in isoform 3 and isoform 4. 1 PublicationVSP_034800Add
BLAST
Alternative sequencei45 – 6723Missing in isoform 5 and isoform 6. 2 PublicationsVSP_034801Add
BLAST
Alternative sequencei211 – 2111P → PDEDTDMYNTPYTYNA in isoform 2, isoform 3, isoform 5 and isoform 6. 3 PublicationsVSP_034802
Alternative sequencei308 – 3081P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPRPSAPDLSPTRTGRINP ADIDLENEPWYKFFSELEFG HPPPKKALDYVQDHSSGVSN E in isoform 2. 1 PublicationVSP_034803
Alternative sequencei308 – 3081P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPCPSAPDLSPTRPPKKAL DYVQDHSSGVSNE in isoform 5. 2 PublicationsVSP_034804
Alternative sequencei309 – 3168VSIYQSSI → RSVSSRPL in isoform 6. 1 PublicationVSP_034805
Alternative sequencei311 – 3133IYQ → PCH in isoform 7. 1 PublicationVSP_034806
Alternative sequencei314 – 1180867Missing in isoform 7. 1 PublicationVSP_034807Add
BLAST
Alternative sequencei317 – 1180864Missing in isoform 6. 1 PublicationVSP_034808Add
BLAST
Alternative sequencei388 – 914527Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_034809Add
BLAST
Alternative sequencei1126 – 118055FQALY…YVKRL → LQ in isoform 3. 1 PublicationVSP_034810Add
BLAST
Alternative sequencei1126 – 113510Missing in isoform 5. 2 PublicationsVSP_034811

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041051 mRNA. Translation: BAC30799.1.
AK049030 mRNA. Translation: BAC33518.1.
AK079130 mRNA. Translation: BAC37554.1.
AK083429 mRNA. Translation: BAC38913.1.
AK139388 mRNA. Translation: BAE23988.1.
AK140498 mRNA. Translation: BAE24407.1.
BC039163 mRNA. Translation: AAH39163.1.
AK122369 mRNA. Translation: BAC65651.1.
CCDSiCCDS80872.1. [Q3UTJ2-5]
RefSeqiNP_001297636.1. NM_001310707.1.
XP_006509449.1. XM_006509386.1.
UniGeneiMm.211096.
Mm.441720.
Mm.447653.

Genome annotation databases

EnsembliENSMUST00000134675; ENSMUSP00000118160; ENSMUSG00000031626. [Q3UTJ2-6]
ENSMUST00000141039; ENSMUSP00000117544; ENSMUSG00000031626. [Q3UTJ2-6]
ENSMUST00000153798; ENSMUSP00000118353; ENSMUSG00000031626. [Q3UTJ2-3]
GeneIDi234214.
KEGGimmu:234214.
UCSCiuc009lpb.2. mouse. [Q3UTJ2-6]
uc009lpc.2. mouse. [Q3UTJ2-1]
uc009lpf.1. mouse. [Q3UTJ2-3]
uc009lpi.2. mouse. [Q3UTJ2-4]
uc029wsw.1. mouse. [Q3UTJ2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041051 mRNA. Translation: BAC30799.1.
AK049030 mRNA. Translation: BAC33518.1.
AK079130 mRNA. Translation: BAC37554.1.
AK083429 mRNA. Translation: BAC38913.1.
AK139388 mRNA. Translation: BAE23988.1.
AK140498 mRNA. Translation: BAE24407.1.
BC039163 mRNA. Translation: AAH39163.1.
AK122369 mRNA. Translation: BAC65651.1.
CCDSiCCDS80872.1. [Q3UTJ2-5]
RefSeqiNP_001297636.1. NM_001310707.1.
XP_006509449.1. XM_006509386.1.
UniGeneiMm.211096.
Mm.441720.
Mm.447653.

3D structure databases

ProteinModelPortaliQ3UTJ2.
SMRiQ3UTJ2. Positions 944-1180.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231503. 8 interactions.
IntActiQ3UTJ2. 4 interactions.
MINTiMINT-1853612.
STRINGi10090.ENSMUSP00000128000.

PTM databases

iPTMnetiQ3UTJ2.
PhosphoSiteiQ3UTJ2.

Proteomic databases

MaxQBiQ3UTJ2.
PaxDbiQ3UTJ2.
PeptideAtlasiQ3UTJ2.
PRIDEiQ3UTJ2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000134675; ENSMUSP00000118160; ENSMUSG00000031626. [Q3UTJ2-6]
ENSMUST00000141039; ENSMUSP00000117544; ENSMUSG00000031626. [Q3UTJ2-6]
ENSMUST00000153798; ENSMUSP00000118353; ENSMUSG00000031626. [Q3UTJ2-3]
GeneIDi234214.
KEGGimmu:234214.
UCSCiuc009lpb.2. mouse. [Q3UTJ2-6]
uc009lpc.2. mouse. [Q3UTJ2-1]
uc009lpf.1. mouse. [Q3UTJ2-3]
uc009lpi.2. mouse. [Q3UTJ2-4]
uc029wsw.1. mouse. [Q3UTJ2-2]

Organism-specific databases

CTDi8470.
MGIiMGI:1924574. Sorbs2.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410KCZT. Eukaryota.
ENOG410XNVJ. LUCA.
GeneTreeiENSGT00760000119190.
HOVERGENiHBG108509.
InParanoidiQ3UTJ2.

Miscellaneous databases

PROiQ3UTJ2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031626.
ExpressionAtlasiQ3UTJ2. baseline and differential.
GenevisibleiQ3UTJ2. MM.

Family and domain databases

InterProiIPR028516. ArgBP2.
IPR001452. SH3_domain.
IPR003127. SoHo_dom.
IPR007087. Znf_C2H2.
[Graphical view]
PANTHERiPTHR10663:SF207. PTHR10663:SF207. 1 hit.
PfamiPF00018. SH3_1. 2 hits.
PF14604. SH3_9. 1 hit.
PF02208. Sorb. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 3 hits.
SM00459. Sorb. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 3 hits.
PROSITEiPS50002. SH3. 3 hits.
PS50831. SOHO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRBS2_MOUSE
AccessioniPrimary (citable) accession number: Q3UTJ2
Secondary accession number(s): Q3USC6
, Q80TS1, Q8BJL6, Q8BJU3, Q8BLW9, Q8BX47, Q8CHU0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: September 7, 2016
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.