Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epithelial splicing regulatory protein 1

Gene

Esrp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). Acts by directly binding specific sequences in mRNAs. Binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2 (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Epithelial splicing regulatory protein 1
Alternative name(s):
RNA-binding motif protein 35A
RNA-binding protein 35A
Gene namesi
Name:Esrp1
Synonyms:Rbm35a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1917326. Esrp1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 680680Epithelial splicing regulatory protein 1PRO_0000273047Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei542 – 5421PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ3US41.
PaxDbiQ3US41.
PRIDEiQ3US41.

Expressioni

Tissue specificityi

Epithelial cell-specific. Epithelial-specific expression in diverse tissues and organs with particularly notable levels of expression in skin and gastrointestinal epithelia.1 Publication

Gene expression databases

BgeeiQ3US41.
CleanExiMM_RBM35A.
ExpressionAtlasiQ3US41. baseline and differential.
GenevisibleiQ3US41. MM.

Interactioni

Protein-protein interaction databases

BioGridi228933. 1 interaction.
STRINGi10090.ENSMUSP00000103947.

Structurei

3D structure databases

ProteinModelPortaliQ3US41.
SMRiQ3US41. Positions 226-300, 313-418, 446-531, 631-667.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini224 – 30178RRM 1PROSITE-ProRule annotationAdd
BLAST
Domaini325 – 40581RRM 2PROSITE-ProRule annotationAdd
BLAST
Domaini444 – 52481RRM 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the ESRP family.Curated
Contains 3 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1365. Eukaryota.
ENOG410XPZU. LUCA.
GeneTreeiENSGT00760000119102.
InParanoidiQ3US41.
KOiK14947.
OrthoDBiEOG76QFGV.
PhylomeDBiQ3US41.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
3.30.70.330. 3 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR012337. RNaseH-like_dom.
IPR000504. RRM_dom.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
SSF54928. SSF54928. 3 hits.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3US41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTASPDYLVV LFGITAGATG AKLGSDEKEL ILLLWKVVDL ANKKVGQLHE
60 70 80 90 100
VLVRPDQLEL TEDCKEETKI DAENLSSAPQ LDQALRQFNQ SVSNELNIGV
110 120 130 140 150
GTSFCLCTDG QLHIRQILHP EASKKNVLLP ECFYSFFDLR KEFKKCCPGS
160 170 180 190 200
PDIDKLDVAA MTESLNFEKS DSVSRYGASQ VEDMGNIILA MISEPYNHRF
210 220 230 240 250
SDPERVNYKF ESGTCKMELI DDSTVVRARG LPWQSSDQDI ARFFKGLNIA
260 270 280 290 300
KGGAALCLNA QGRRNGEALV RFVSEEHRDL ALQRHKHHMG TRYIEVYKAT
310 320 330 340 350
GEDFLKIAGG TSNEVAQFLS KENQVIVRMR GLPFTATAEE VVAFFGQHCP
360 370 380 390 400
ITGGKEGILF VTYPDGRPTG DAFVLFACEE YAQNALRKHK ELLGKRYIEL
410 420 430 440 450
FRSTAAEVQQ VLNRFSSAPL IPLPTPPIIP VLPQQFVPPT NVRDCIRLRG
460 470 480 490 500
LPYAATIEDI LDFLGEFSTD IRTHGVHMVL NHQGRPSGDA FIQMKSTDRA
510 520 530 540 550
FMAAQKYHKK TMKDRYVEVF QCSAEEMNFV LMGGTLNRNG LSPPPCKLPC
560 570 580 590 600
LSPPSYTFPA PTAVIPTEAA IYQPSLLLNP RALQPSTAYY PAGTQLFMNY
610 620 630 640 650
TAYYPSPPGS PNSLGYFPTA ANLSSVPPQP GTVVRMQGLA YNTGVKEILN
660 670 680
FFQGYQYATE DGLVHTNDQA RTLPKEWVCI
Length:680
Mass (Da):75,549
Last modified:May 5, 2009 - v2
Checksum:i972BF5D6AFB5FFD4
GO
Isoform 2 (identifier: Q3US41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: C → CS
     607-607: P → V
     608-680: Missing.

Show »
Length:608
Mass (Da):67,699
Checksum:i8C5BBF61DE635165
GO
Isoform 3 (identifier: Q3US41-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: C → CS
     545-548: Missing.
     607-607: P → V
     608-680: Missing.

Note: No experimental confirmation available.
Show »
Length:604
Mass (Da):67,258
Checksum:iB1CCA1CDC497AECA
GO
Isoform 4 (identifier: Q3US41-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: C → CS
     484-513: GRPSGDAFIQMKSTDRAFMAAQKYHKKTMK → VRGVIGKCVCSFLRPSAPSSITAQRFTLPL
     514-680: Missing.

Note: No experimental confirmation available.
Show »
Length:514
Mass (Da):57,166
Checksum:iE52B30F889C68E8A
GO
Isoform 5 (identifier: Q3US41-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: C → CS
     545-548: Missing.

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):75,195
Checksum:iA64DE9B768A94849
GO

Sequence cautioni

The sequence CAM20812.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM20813.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM20814.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAM20816.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence EDL05650.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti113 – 1131H → N in BAE24496 (PubMed:16141072).Curated
Sequence conflicti127 – 1271V → L in AAH31468 (PubMed:15489334).Curated
Sequence conflicti206 – 2061V → L in AAH31468 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei215 – 2151C → CS in isoform 2, isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_022468
Alternative sequencei484 – 51330GRPSG…KKTMK → VRGVIGKCVCSFLRPSAPSS ITAQRFTLPL in isoform 4. 1 PublicationVSP_022469Add
BLAST
Alternative sequencei514 – 680167Missing in isoform 4. 1 PublicationVSP_022470Add
BLAST
Alternative sequencei545 – 5484Missing in isoform 3 and isoform 5. 1 PublicationVSP_022471
Alternative sequencei607 – 6071P → V in isoform 2 and isoform 3. 1 PublicationVSP_022472
Alternative sequencei608 – 68073Missing in isoform 2 and isoform 3. 1 PublicationVSP_022473Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042164 mRNA. Translation: BAC31189.1.
AK140848 mRNA. Translation: BAE24496.1.
AK166376 mRNA. Translation: BAE38739.1.
AL772170 Genomic DNA. Translation: CAM20812.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20813.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20814.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20815.1.
AL772170 Genomic DNA. Translation: CAM20816.1. Sequence problems.
CH466538 Genomic DNA. Translation: EDL05650.1. Sequence problems.
BC031468 mRNA. Translation: AAH31468.1.
BC059280 mRNA. Translation: AAH59280.1.
RefSeqiNP_001277312.1. NM_001290383.1. [Q3US41-1]
NP_918944.2. NM_194055.3.
XP_006537778.1. XM_006537715.1. [Q3US41-5]
XP_006537781.1. XM_006537718.1. [Q3US41-2]
XP_006537783.1. XM_006537720.1. [Q3US41-3]
UniGeneiMm.387719.

Genome annotation databases

EnsembliENSMUST00000108310; ENSMUSP00000103946; ENSMUSG00000040728. [Q3US41-5]
ENSMUST00000108313; ENSMUSP00000103949; ENSMUSG00000040728. [Q3US41-3]
GeneIDi207920.
KEGGimmu:207920.
UCSCiuc008rzk.3. mouse. [Q3US41-3]
uc008rzl.3. mouse. [Q3US41-2]
uc008rzm.3. mouse. [Q3US41-1]
uc008rzn.1. mouse. [Q3US41-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042164 mRNA. Translation: BAC31189.1.
AK140848 mRNA. Translation: BAE24496.1.
AK166376 mRNA. Translation: BAE38739.1.
AL772170 Genomic DNA. Translation: CAM20812.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20813.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20814.1. Sequence problems.
AL772170 Genomic DNA. Translation: CAM20815.1.
AL772170 Genomic DNA. Translation: CAM20816.1. Sequence problems.
CH466538 Genomic DNA. Translation: EDL05650.1. Sequence problems.
BC031468 mRNA. Translation: AAH31468.1.
BC059280 mRNA. Translation: AAH59280.1.
RefSeqiNP_001277312.1. NM_001290383.1. [Q3US41-1]
NP_918944.2. NM_194055.3.
XP_006537778.1. XM_006537715.1. [Q3US41-5]
XP_006537781.1. XM_006537718.1. [Q3US41-2]
XP_006537783.1. XM_006537720.1. [Q3US41-3]
UniGeneiMm.387719.

3D structure databases

ProteinModelPortaliQ3US41.
SMRiQ3US41. Positions 226-300, 313-418, 446-531, 631-667.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228933. 1 interaction.
STRINGi10090.ENSMUSP00000103947.

Proteomic databases

MaxQBiQ3US41.
PaxDbiQ3US41.
PRIDEiQ3US41.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000108310; ENSMUSP00000103946; ENSMUSG00000040728. [Q3US41-5]
ENSMUST00000108313; ENSMUSP00000103949; ENSMUSG00000040728. [Q3US41-3]
GeneIDi207920.
KEGGimmu:207920.
UCSCiuc008rzk.3. mouse. [Q3US41-3]
uc008rzl.3. mouse. [Q3US41-2]
uc008rzm.3. mouse. [Q3US41-1]
uc008rzn.1. mouse. [Q3US41-4]

Organism-specific databases

CTDi54845.
MGIiMGI:1917326. Esrp1.

Phylogenomic databases

eggNOGiKOG1365. Eukaryota.
ENOG410XPZU. LUCA.
GeneTreeiENSGT00760000119102.
InParanoidiQ3US41.
KOiK14947.
OrthoDBiEOG76QFGV.
PhylomeDBiQ3US41.

Miscellaneous databases

NextBioi372085.
PROiQ3US41.
SOURCEiSearch...

Gene expression databases

BgeeiQ3US41.
CleanExiMM_RBM35A.
ExpressionAtlasiQ3US41. baseline and differential.
GenevisibleiQ3US41. MM.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
3.30.70.330. 3 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR012337. RNaseH-like_dom.
IPR000504. RRM_dom.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
SSF54928. SSF54928. 3 hits.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 14-680 (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Head, Mammary gland and Thymus.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 118-607 (ISOFORM 3).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor.
  5. "ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing."
    Warzecha C.C., Sato T.K., Nabet B., Hogenesch J.B., Carstens R.P.
    Mol. Cell 33:591-601(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Pancreas.

Entry informationi

Entry nameiESRP1_MOUSE
AccessioniPrimary (citable) accession number: Q3US41
Secondary accession number(s): A2AJQ4
, A2AJQ5, A2AJQ6, A2AJQ7, A2AJQ8, Q3TLQ3, Q6PCL4, Q8C9F5, Q8K0G2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: May 5, 2009
Last modified: February 17, 2016
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.