Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-coenzyme A synthetase ACSM3, mitochondrial

Gene

Acsm3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).1 Publication

Catalytic activityi

ATP + a carboxylate + CoA = AMP + diphosphate + an acyl-CoA.

Cofactori

Mg2+By similarity, Mn2+By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei455 – 4551ATPBy similarity
Binding sitei470 – 4701ATPBy similarity
Binding sitei566 – 5661ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi229 – 2379ATPBy similarity
Nucleotide bindingi368 – 3736ATPBy similarity

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • butyrate-CoA ligase activity Source: UniProtKB-EC
  • fatty acid ligase activity Source: MGI
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • fatty acid biosynthetic process Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Fatty acid metabolism, Lipid metabolism

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Chemistry

SwissLipidsiSLP:000001206.

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-coenzyme A synthetase ACSM3, mitochondrial (EC:6.2.1.2)
Alternative name(s):
Acyl-CoA synthetase medium-chain family member 3
Butyrate--CoA ligase 3
Butyryl-coenzyme A synthetase 3
Middle-chain acyl-CoA synthetase 3
Protein SA homolog
Gene namesi
Name:Acsm3
Synonyms:Sa, Sah
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:99538. Acsm3.

Subcellular locationi

GO - Cellular componenti

  • mitochondrial matrix Source: MGI
  • mitochondrion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2121MitochondrionSequence analysisAdd
BLAST
Chaini22 – 580559Acyl-coenzyme A synthetase ACSM3, mitochondrialPRO_0000306098Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei67 – 671N6-succinyllysineCombined sources
Modified residuei100 – 1001N6-succinyllysineCombined sources
Modified residuei151 – 1511N6-acetyllysineCombined sources

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ3UNX5.
PaxDbiQ3UNX5.
PeptideAtlasiQ3UNX5.
PRIDEiQ3UNX5.

PTM databases

iPTMnetiQ3UNX5.
PhosphoSiteiQ3UNX5.
SwissPalmiQ3UNX5.

Expressioni

Tissue specificityi

Detected in kidney (at protein level). Detected in kidney proximal tubules and in liver. Detected at low levels in testis, stomach, heart and lung.4 Publications

Inductioni

Up-regulated in kidney by androgens. Down-regulated in kidney by estrogens. Levels in kidney are very low in female C57BL/6 mice and in castrated male C57BL/6, 129/SvJ and BALB/c mice. Constitutively expressed in liver.2 Publications

Gene expression databases

BgeeiENSMUSG00000030935.
CleanExiMM_ACSM3.
GenevisibleiQ3UNX5. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068803.

Structurei

3D structure databases

ProteinModelPortaliQ3UNX5.
SMRiQ3UNX5. Positions 47-577.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1175. Eukaryota.
COG0365. LUCA.
GeneTreeiENSGT00760000119178.
HOGENOMiHOG000229982.
HOVERGENiHBG053031.
InParanoidiQ3UNX5.
KOiK01896.
OMAiAIPKAYV.
OrthoDBiEOG091G03NW.
PhylomeDBiQ3UNX5.
TreeFamiTF354287.

Family and domain databases

InterProiIPR025110. AMP-bd_C.
IPR020845. AMP-binding_CS.
IPR000873. AMP-dep_Synth/Lig.
[Graphical view]
PfamiPF00501. AMP-binding. 1 hit.
PF13193. AMP-binding_C. 1 hit.
[Graphical view]
PROSITEiPS00455. AMP_BINDING. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UNX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVMLLRARCF QRLAIPDPMR VLYKDYRTAT PQNFSNYESM KQDFKIEIPE
60 70 80 90 100
YFNFAKDVLD QWTNMEKAGK RLSNPAFWWI DGNGEELRWS FEELGLLSRK
110 120 130 140 150
FANILTEACS LQRGDRVMVI LPKIPEWWLA NVACLRTGTV LIPGTTQLTQ
160 170 180 190 200
KDILYRLQSS KAKCIITDDT LAPAVDAVAA KCENLHSKLI VSQHSREGWG
210 220 230 240 250
NLKEMMKYAS DSHTCVDTKH DEMMAIYFTS GTTGPPKMIG HTHSSFGLGL
260 270 280 290 300
SVNGRFWLDL IASDVMWNTS DTGWAKSAWS SVFSPWTQGA CVFAHYLPRF
310 320 330 340 350
ESTSILQTLS KFPITVFCSA PTAYRMLVQN DMSSYKFNSL KHCVSAGEPI
360 370 380 390 400
NPEVMEQWRK KTGLDIYEGY GQTETVLICG NFKGMKIKPG SMGKPSPAFD
410 420 430 440 450
VKILDENGAT LPPGQEGDIA LQVLPERPFG LFTHYVDNPS KTASTLRGSF
460 470 480 490 500
YITGDRGYMD EDGYFWFVAR SDDIILSSGY RIGPFEVESA LIEHPSIAES
510 520 530 540 550
AVVSSPDPIR GEVVKAFIVL NPDYKSHDQE QLKKEIQEHV KKTTAPYKYP
560 570 580
RKVEFIEELP KTVSGKVKRN ELRKKEWVTT
Length:580
Mass (Da):65,623
Last modified:October 2, 2007 - v2
Checksum:iCAF3D06A0B4A2778
GO
Isoform 2 (identifier: Q3UNX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     578-580: VTT → EQGLLHEQMTVDRLLGKSARHERHVPSVCMNCSGVAAVLRYAEAA

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):70,238
Checksum:i4F98E4406704D0F2
GO

Sequence cautioni

The sequence AAC79656 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH15248 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAL40880 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA37141 differs from that shown. Reason: Frameshift at positions 1, 63 and 72. Curated
The sequence BAE38232 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti137 – 1371T → P in AAC79656 (PubMed:15525578).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei578 – 5803VTT → EQGLLHEQMTVDRLLGKSAR HERHVPSVCMNCSGVAAVLR YAEAA in isoform 2. 1 PublicationVSP_028397

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY064696 mRNA. Translation: AAL40880.1. Different initiation.
AB022340 mRNA. Translation: BAA37141.1. Frameshift.
AF068246 mRNA. Translation: AAC79656.1. Different initiation.
AK041060 mRNA. Translation: BAC30805.1.
AK143946 mRNA. Translation: BAE25622.1.
AK165516 mRNA. Translation: BAE38232.1. Different initiation.
BC015248 mRNA. Translation: AAH15248.1. Different initiation.
CCDSiCCDS21786.1. [Q3UNX5-1]
RefSeqiNP_058566.3. NM_016870.3. [Q3UNX5-1]
NP_997606.2. NM_212441.2. [Q3UNX5-1]
NP_997607.2. NM_212442.2. [Q3UNX5-1]
UniGeneiMm.334199.

Genome annotation databases

EnsembliENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935. [Q3UNX5-2]
GeneIDi20216.
KEGGimmu:20216.
UCSCiuc009jlq.1. mouse. [Q3UNX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY064696 mRNA. Translation: AAL40880.1. Different initiation.
AB022340 mRNA. Translation: BAA37141.1. Frameshift.
AF068246 mRNA. Translation: AAC79656.1. Different initiation.
AK041060 mRNA. Translation: BAC30805.1.
AK143946 mRNA. Translation: BAE25622.1.
AK165516 mRNA. Translation: BAE38232.1. Different initiation.
BC015248 mRNA. Translation: AAH15248.1. Different initiation.
CCDSiCCDS21786.1. [Q3UNX5-1]
RefSeqiNP_058566.3. NM_016870.3. [Q3UNX5-1]
NP_997606.2. NM_212441.2. [Q3UNX5-1]
NP_997607.2. NM_212442.2. [Q3UNX5-1]
UniGeneiMm.334199.

3D structure databases

ProteinModelPortaliQ3UNX5.
SMRiQ3UNX5. Positions 47-577.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068803.

Chemistry

SwissLipidsiSLP:000001206.

PTM databases

iPTMnetiQ3UNX5.
PhosphoSiteiQ3UNX5.
SwissPalmiQ3UNX5.

Proteomic databases

MaxQBiQ3UNX5.
PaxDbiQ3UNX5.
PeptideAtlasiQ3UNX5.
PRIDEiQ3UNX5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935. [Q3UNX5-1]
ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935. [Q3UNX5-2]
GeneIDi20216.
KEGGimmu:20216.
UCSCiuc009jlq.1. mouse. [Q3UNX5-1]

Organism-specific databases

CTDi6296.
MGIiMGI:99538. Acsm3.

Phylogenomic databases

eggNOGiKOG1175. Eukaryota.
COG0365. LUCA.
GeneTreeiENSGT00760000119178.
HOGENOMiHOG000229982.
HOVERGENiHBG053031.
InParanoidiQ3UNX5.
KOiK01896.
OMAiAIPKAYV.
OrthoDBiEOG091G03NW.
PhylomeDBiQ3UNX5.
TreeFamiTF354287.

Miscellaneous databases

ChiTaRSiAcsm3. mouse.
PROiQ3UNX5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030935.
CleanExiMM_ACSM3.
GenevisibleiQ3UNX5. MM.

Family and domain databases

InterProiIPR025110. AMP-bd_C.
IPR020845. AMP-binding_CS.
IPR000873. AMP-dep_Synth/Lig.
[Graphical view]
PfamiPF00501. AMP-binding. 1 hit.
PF13193. AMP-binding_C. 1 hit.
[Graphical view]
PROSITEiPS00455. AMP_BINDING. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiACSM3_MOUSE
AccessioniPrimary (citable) accession number: Q3UNX5
Secondary accession number(s): Q8BRY2
, Q91WI1, Q9Z2F3, Q9Z2X0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: September 7, 2016
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-3 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.