Reviewed,
UniProtKB/Swiss-Prot Q3UNX5 (ACSM3_MOUSE)
Last modified
June 16, 2009.
Version 31.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Acyl-coenzyme A synthetase ACSM3, mitochondrial EC=6.2.1.2 Alternative name(s): Acyl-CoA synthetase medium-chain family member 3 Middle-chain acyl-CoA synthetase 3 Butyryl coenzyme A synthetase 3 Butyrate--CoA ligase 3 Protein SA homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 580 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro). Ref.6 |
| Catalytic activity | ATP + an acid + CoA = AMP + diphosphate + an acyl-CoA. |
| Cofactor | Magnesium or manganese By similarity. |
| Subcellular location | |
| Tissue specificity | Detected in kidney (at protein level). Detected in kidney proximal tubules and in liver. Detected at low levels in testis, stomach, heart and lung. Ref.6 Ref.3 Ref.1 Ref.2 |
| Induction | Up-regulated in kidney by androgens. Down-regulated in kidney by estrogens. Levels in kidney are very low in female C57BL/6 mice and in castrated male C57BL/6, 129/SvJ and BALB/c mice. Constitutively expressed in liver. Ref.3 Ref.1 |
| Sequence similarities | Belongs to the ATP-dependent AMP-binding enzyme family. |
| Caution | It is uncertain whether Met-1 or Met-3 is the initiator. |
| Sequence caution | The sequence BAA37141.1 differs from that shown. Reason: Frameshift at positions 1, 63 and 72. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Fatty acid metabolism Lipid metabolism |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Ligase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | fatty acid biosynthetic process Ref.6 Inferred from direct assay. Source: MGI |
| Cellular component | mitochondrial matrix Ref.6 Inferred from direct assay. Source: MGI |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW butyrate-CoA ligase activityInferred from electronic annotation. Source: EC fatty-acid ligase activity Ref.6Inferred from direct assay. Source: MGI magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3UNX5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3UNX5-2) The sequence of this isoform differs from the canonical sequence as follows: 578-580: VTT → EQGLLHEQMTVDRLLGKSARHERHVPSVCMNCSGVAAVLRYAEAA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 21 | 21 | Mitochondrion Potential | ||||||
| Chain | 22 – 580 | 559 | Acyl-coenzyme A synthetase ACSM3, mitochondrial | PRO_0000306098 | |||||
Regions | |||||||||
| Nucleotide binding | 229 – 237 | 9 | ATP By similarity | ||||||
| Nucleotide binding | 368 – 373 | 6 | ATP By similarity | ||||||
Sites | |||||||||
| Binding site | 455 | 1 | ATP By similarity | ||||||
| Binding site | 470 | 1 | ATP By similarity | ||||||
| Binding site | 566 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 37 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 578 – 580 | 3 | VTT → EQGLLHEQMTVDRLLGKSAR HERHVPSVCMNCSGVAAVLR YAEAA in isoform 2. | VSP_028397 | |||||
Experimental info | |||||||||
| Sequence conflict | 137 | 1 | T → P in AAC79656. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of androgen-regulated genes in mouse kidney by representational difference analysis and random arbitrarily primed polymerase chain reaction." Melia M.J., Bofill N., Hubank M., Meseguer A. Endocrinology 139:688-695(1998) [PubMed: 9449642] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION. Strain: C57BL/6. |
| [2] | "Isolation of genes identified in mouse renal proximal tubule by comparing different gene expression profiles." Takenaka M., Imai E., Kaneko T., Ito T., Moriyama T., Yamauchi A., Hori M., Kawamoto S., Okubo K. Kidney Int. 53:562-572(1998) [PubMed: 9507200] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Kidney. |
| [3] | "Sex steroid regulation and identification of different transcription units of the SA gene in mouse kidney." Areste C., Melia M.J., Isern J., Tovar J.L., Meseguer A. J. Endocrinol. 183:101-114(2004) [PubMed: 15525578] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INDUCTION, TISSUE SPECIFICITY. Strain: 129/SvJ. Tissue: Kidney. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Aorta, Kidney and Vein. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Kidney. |
| [6] | "Molecular identification and characterization of two medium-chain acyl-CoA synthetases, MACS1 and the Sa gene product." Fujino T., Takei Y.A., Sone H., Ioka R.X., Kamataki A., Magoori K., Takahashi S., Sakai J., Yamamoto T.T. J. Biol. Chem. 276:35961-35966(2001) [PubMed: 11470804] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY064696 mRNA. Translation: AAL40880.1. Different initiation. AB022340 mRNA. Translation: BAA37141.1. Frameshift. AF068246 mRNA. Translation: AAC79656.1. Different initiation. AK041060 mRNA. Translation: BAC30805.1. AK143946 mRNA. Translation: BAE25622.1. AK165516 mRNA. Translation: BAE38232.1. Different initiation. BC015248 mRNA. Translation: AAH15248.1. Different initiation. | |
| IPI | IPI00387345. IPI00762478. |
| RefSeq | NP_058566.3. NP_997606.2. NP_997607.2. |
| UniGene | Mm.334199 |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q3UNX5. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000030935. Mus musculus. [Contig view] |
| GeneID | 20216. |
| KEGG | mmu:20216. |
Organism-specific databases | |
| MGI | MGI:99538. Acsm3. |
Phylogenomic databases | |
| HOGENOM | Q3UNX5. |
| HOVERGEN | Q3UNX5. |
| OMA | Q3UNX5. CENLHSK. |
Enzyme and pathway databases | |
| BRENDA | 6.2.1.2. 244. |
Gene expression databases | |
| Bgee | Q3UNX5. |
| CleanEx | MM_ACSM3. |
Family and domain databases | |
| InterPro | IPR000873. AMP-dep_Synth/Lig. [Graphical view] |
| Pfam | PF00501. AMP-binding. 1 hit. [Graphical view] |
| PROSITE | PS00455. AMP_BINDING. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 297817. |
| SOURCE | Search... |
Entry information
| Entry name | ACSM3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3UNX5 Secondary accession number(s): Q8BRY2 Q9Z2X0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


