Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arginine and glutamate-rich protein 1

Gene

Arglu1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Arginine and glutamate-rich protein 1
Gene namesi
Name:Arglu1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2442985. Arglu1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002884391 – 271Arginine and glutamate-rich protein 1Add BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei58PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei61PhosphothreonineBy similarity1
Modified residuei74PhosphoserineBy similarity1
Modified residuei75PhosphoserineCombined sources1
Modified residuei264PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ3UL36.
MaxQBiQ3UL36.
PaxDbiQ3UL36.
PeptideAtlasiQ3UL36.
PRIDEiQ3UL36.

PTM databases

iPTMnetiQ3UL36.
PhosphoSitePlusiQ3UL36.

Expressioni

Gene expression databases

BgeeiENSMUSG00000040459.
CleanExiMM_ARGLU1.
ExpressionAtlasiQ3UL36. baseline and differential.
GenevisibleiQ3UL36. MM.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ3UL36. 1 interactor.
STRINGi10090.ENSMUSP00000039493.

Structurei

3D structure databases

ProteinModelPortaliQ3UL36.
SMRiQ3UL36.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi3 – 72Arg-richAdd BLAST70
Compositional biasi95 – 249Glu-richAdd BLAST155

Sequence similaritiesi

Belongs to the UPF0430 family.Curated

Phylogenomic databases

eggNOGiENOG410IHEN. Eukaryota.
ENOG4111J08. LUCA.
GeneTreeiENSGT00730000111249.
HOGENOMiHOG000030700.
HOVERGENiHBG096780.
InParanoidiQ3UL36.
KOiK13173.
OMAiQPAENTY.
PhylomeDBiQ3UL36.
TreeFamiTF324123.

Family and domain databases

InterProiIPR033371. ARGLU1.
[Graphical view]
PANTHERiPTHR31711. PTHR31711. 1 hit.
PfamiPF15346. ARGLU. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UL36-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRSRSRSSS RSKHTKSSKH NKKRSRSRSR SRDKERVRKR SKSRESKRNR
60 70 80 90 100
RRESRSRSRS TNAAASRRER ERASSPPDRI DIFGRTVSKR SSLDEKQKRE
110 120 130 140 150
EEEKKAEFER QRKIRQQEIE EKLIEEETAR RVEELVAKRV EEELEKRKDE
160 170 180 190 200
IEREVLRRVE EAKRIMEKQL LEELERQRQA ELAAQKAREE EERAKREELE
210 220 230 240 250
RILEENNRKI AEAQAKLAEE QLRIVEEQRK IHEERMKLEQ ERQRQQKEEQ
260 270
KIILGKGKSR PKLSFSLKTQ D
Length:271
Mass (Da):32,887
Last modified:May 29, 2007 - v2
Checksum:iA17012F236A37340
GO
Isoform 2 (identifier: Q3UL36-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-69: Missing.
     190-271: EEERAKREEL...KLSFSLKTQD → VTLGRLESRDSPWQNFQCQVCLLLSPERDGMRLS

Note: No experimental confirmation available.
Show »
Length:205
Mass (Da):24,796
Checksum:iA268AE0907A7D7BF
GO

Sequence cautioni

The sequence BAE26615 differs from that shown. Chimeric cDNA.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02567552 – 69Missing in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_025676190 – 271EEERA…LKTQD → VTLGRLESRDSPWQNFQCQV CLLLSPERDGMRLS in isoform 2. 1 PublicationAdd BLAST82

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138368 Genomic DNA. No translation available.
BC046971 mRNA. Translation: AAH46971.1.
AK145733 mRNA. Translation: BAE26615.1. Sequence problems.
CCDSiCCDS40215.1. [Q3UL36-1]
RefSeqiNP_789819.2. NM_176849.3. [Q3UL36-1]
UniGeneiMm.251655.

Genome annotation databases

EnsembliENSMUST00000048545; ENSMUSP00000039493; ENSMUSG00000040459. [Q3UL36-1]
GeneIDi234023.
KEGGimmu:234023.
UCSCiuc009kug.1. mouse. [Q3UL36-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138368 Genomic DNA. No translation available.
BC046971 mRNA. Translation: AAH46971.1.
AK145733 mRNA. Translation: BAE26615.1. Sequence problems.
CCDSiCCDS40215.1. [Q3UL36-1]
RefSeqiNP_789819.2. NM_176849.3. [Q3UL36-1]
UniGeneiMm.251655.

3D structure databases

ProteinModelPortaliQ3UL36.
SMRiQ3UL36.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ3UL36. 1 interactor.
STRINGi10090.ENSMUSP00000039493.

PTM databases

iPTMnetiQ3UL36.
PhosphoSitePlusiQ3UL36.

Proteomic databases

EPDiQ3UL36.
MaxQBiQ3UL36.
PaxDbiQ3UL36.
PeptideAtlasiQ3UL36.
PRIDEiQ3UL36.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000048545; ENSMUSP00000039493; ENSMUSG00000040459. [Q3UL36-1]
GeneIDi234023.
KEGGimmu:234023.
UCSCiuc009kug.1. mouse. [Q3UL36-1]

Organism-specific databases

CTDi55082.
MGIiMGI:2442985. Arglu1.

Phylogenomic databases

eggNOGiENOG410IHEN. Eukaryota.
ENOG4111J08. LUCA.
GeneTreeiENSGT00730000111249.
HOGENOMiHOG000030700.
HOVERGENiHBG096780.
InParanoidiQ3UL36.
KOiK13173.
OMAiQPAENTY.
PhylomeDBiQ3UL36.
TreeFamiTF324123.

Miscellaneous databases

PROiQ3UL36.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040459.
CleanExiMM_ARGLU1.
ExpressionAtlasiQ3UL36. baseline and differential.
GenevisibleiQ3UL36. MM.

Family and domain databases

InterProiIPR033371. ARGLU1.
[Graphical view]
PANTHERiPTHR31711. PTHR31711. 1 hit.
PfamiPF15346. ARGLU. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARGL1_MOUSE
AccessioniPrimary (citable) accession number: Q3UL36
Secondary accession number(s): Q80XJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: November 30, 2016
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.