Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3UL36

- ARGL1_MOUSE

UniProt

Q3UL36 - ARGL1_MOUSE

Protein

Arginine and glutamate-rich protein 1

Gene

Arglu1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 64 (01 Oct 2014)
      Sequence version 2 (29 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Arginine and glutamate-rich protein 1
    Gene namesi
    Name:Arglu1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 8

    Organism-specific databases

    MGIiMGI:2442985. Arglu1.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 271271Arginine and glutamate-rich protein 1PRO_0000288439Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei58 – 581PhosphoserineBy similarity
    Modified residuei60 – 601PhosphoserineBy similarity
    Modified residuei61 – 611PhosphothreonineBy similarity
    Modified residuei75 – 751Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ3UL36.
    PRIDEiQ3UL36.

    PTM databases

    PhosphoSiteiQ3UL36.

    Expressioni

    Gene expression databases

    BgeeiQ3UL36.
    CleanExiMM_ARGLU1.
    GenevestigatoriQ3UL36.

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi3 – 7270Arg-richAdd
    BLAST
    Compositional biasi95 – 249155Glu-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the UPF0430 family.Curated

    Phylogenomic databases

    eggNOGiNOG87986.
    GeneTreeiENSGT00730000111249.
    HOGENOMiHOG000030700.
    HOVERGENiHBG096780.
    InParanoidiQ3UL36.
    KOiK13173.
    OMAiNTDYLIP.
    OrthoDBiEOG71CFQN.
    PhylomeDBiQ3UL36.
    TreeFamiTF324123.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q3UL36-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGRSRSRSSS RSKHTKSSKH NKKRSRSRSR SRDKERVRKR SKSRESKRNR    50
    RRESRSRSRS TNAAASRRER ERASSPPDRI DIFGRTVSKR SSLDEKQKRE 100
    EEEKKAEFER QRKIRQQEIE EKLIEEETAR RVEELVAKRV EEELEKRKDE 150
    IEREVLRRVE EAKRIMEKQL LEELERQRQA ELAAQKAREE EERAKREELE 200
    RILEENNRKI AEAQAKLAEE QLRIVEEQRK IHEERMKLEQ ERQRQQKEEQ 250
    KIILGKGKSR PKLSFSLKTQ D 271
    Length:271
    Mass (Da):32,887
    Last modified:May 29, 2007 - v2
    Checksum:iA17012F236A37340
    GO
    Isoform 2 (identifier: Q3UL36-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         52-69: Missing.
         190-271: EEERAKREEL...KLSFSLKTQD → VTLGRLESRDSPWQNFQCQVCLLLSPERDGMRLS

    Note: No experimental confirmation available.

    Show »
    Length:205
    Mass (Da):24,796
    Checksum:iA268AE0907A7D7BF
    GO

    Sequence cautioni

    The sequence BAE26615.1 differs from that shown. Reason: Chimeric cDNA.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei52 – 6918Missing in isoform 2. 1 PublicationVSP_025675Add
    BLAST
    Alternative sequencei190 – 27182EEERA…LKTQD → VTLGRLESRDSPWQNFQCQV CLLLSPERDGMRLS in isoform 2. 1 PublicationVSP_025676Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC138368 Genomic DNA. No translation available.
    BC046971 mRNA. Translation: AAH46971.1.
    AK145733 mRNA. Translation: BAE26615.1. Sequence problems.
    CCDSiCCDS40215.1. [Q3UL36-1]
    RefSeqiNP_789819.2. NM_176849.3. [Q3UL36-1]
    UniGeneiMm.251655.

    Genome annotation databases

    EnsembliENSMUST00000048545; ENSMUSP00000039493; ENSMUSG00000040459. [Q3UL36-1]
    GeneIDi234023.
    KEGGimmu:234023.
    UCSCiuc009kug.1. mouse. [Q3UL36-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC138368 Genomic DNA. No translation available.
    BC046971 mRNA. Translation: AAH46971.1 .
    AK145733 mRNA. Translation: BAE26615.1 . Sequence problems.
    CCDSi CCDS40215.1. [Q3UL36-1 ]
    RefSeqi NP_789819.2. NM_176849.3. [Q3UL36-1 ]
    UniGenei Mm.251655.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q3UL36.

    Proteomic databases

    MaxQBi Q3UL36.
    PRIDEi Q3UL36.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000048545 ; ENSMUSP00000039493 ; ENSMUSG00000040459 . [Q3UL36-1 ]
    GeneIDi 234023.
    KEGGi mmu:234023.
    UCSCi uc009kug.1. mouse. [Q3UL36-1 ]

    Organism-specific databases

    CTDi 55082.
    MGIi MGI:2442985. Arglu1.

    Phylogenomic databases

    eggNOGi NOG87986.
    GeneTreei ENSGT00730000111249.
    HOGENOMi HOG000030700.
    HOVERGENi HBG096780.
    InParanoidi Q3UL36.
    KOi K13173.
    OMAi NTDYLIP.
    OrthoDBi EOG71CFQN.
    PhylomeDBi Q3UL36.
    TreeFami TF324123.

    Miscellaneous databases

    NextBioi 381992.
    PROi Q3UL36.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q3UL36.
    CleanExi MM_ARGLU1.
    Genevestigatori Q3UL36.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Eye.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-190.
      Strain: C57BL/6J.
    4. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiARGL1_MOUSE
    AccessioniPrimary (citable) accession number: Q3UL36
    Secondary accession number(s): Q80XJ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 29, 2007
    Last modified: October 1, 2014
    This is version 64 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families
    3. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3