Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3UL36

- ARGL1_MOUSE

UniProt

Q3UL36 - ARGL1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Arginine and glutamate-rich protein 1

Gene

Arglu1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Arginine and glutamate-rich protein 1
Gene namesi
Name:Arglu1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:2442985. Arglu1.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: Ensembl
  2. nucleus Source: Ensembl
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 271271Arginine and glutamate-rich protein 1PRO_0000288439Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei58 – 581PhosphoserineBy similarity
Modified residuei60 – 601PhosphoserineBy similarity
Modified residuei61 – 611PhosphothreonineBy similarity
Modified residuei75 – 751Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ3UL36.
PRIDEiQ3UL36.

PTM databases

PhosphoSiteiQ3UL36.

Expressioni

Gene expression databases

BgeeiQ3UL36.
CleanExiMM_ARGLU1.
GenevestigatoriQ3UL36.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi3 – 7270Arg-richAdd
BLAST
Compositional biasi95 – 249155Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the UPF0430 family.Curated

Phylogenomic databases

eggNOGiNOG87986.
GeneTreeiENSGT00730000111249.
HOGENOMiHOG000030700.
HOVERGENiHBG096780.
InParanoidiQ3UL36.
KOiK13173.
OMAiNTDYLIP.
OrthoDBiEOG71CFQN.
PhylomeDBiQ3UL36.
TreeFamiTF324123.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3UL36-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRSRSRSSS RSKHTKSSKH NKKRSRSRSR SRDKERVRKR SKSRESKRNR
60 70 80 90 100
RRESRSRSRS TNAAASRRER ERASSPPDRI DIFGRTVSKR SSLDEKQKRE
110 120 130 140 150
EEEKKAEFER QRKIRQQEIE EKLIEEETAR RVEELVAKRV EEELEKRKDE
160 170 180 190 200
IEREVLRRVE EAKRIMEKQL LEELERQRQA ELAAQKAREE EERAKREELE
210 220 230 240 250
RILEENNRKI AEAQAKLAEE QLRIVEEQRK IHEERMKLEQ ERQRQQKEEQ
260 270
KIILGKGKSR PKLSFSLKTQ D
Length:271
Mass (Da):32,887
Last modified:May 29, 2007 - v2
Checksum:iA17012F236A37340
GO
Isoform 2 (identifier: Q3UL36-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-69: Missing.
     190-271: EEERAKREEL...KLSFSLKTQD → VTLGRLESRDSPWQNFQCQVCLLLSPERDGMRLS

Note: No experimental confirmation available.

Show »
Length:205
Mass (Da):24,796
Checksum:iA268AE0907A7D7BF
GO

Sequence cautioni

The sequence BAE26615.1 differs from that shown. Reason: Chimeric cDNA.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei52 – 6918Missing in isoform 2. 1 PublicationVSP_025675Add
BLAST
Alternative sequencei190 – 27182EEERA…LKTQD → VTLGRLESRDSPWQNFQCQV CLLLSPERDGMRLS in isoform 2. 1 PublicationVSP_025676Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138368 Genomic DNA. No translation available.
BC046971 mRNA. Translation: AAH46971.1.
AK145733 mRNA. Translation: BAE26615.1. Sequence problems.
CCDSiCCDS40215.1. [Q3UL36-1]
RefSeqiNP_789819.2. NM_176849.3. [Q3UL36-1]
UniGeneiMm.251655.

Genome annotation databases

EnsembliENSMUST00000048545; ENSMUSP00000039493; ENSMUSG00000040459. [Q3UL36-1]
GeneIDi234023.
KEGGimmu:234023.
UCSCiuc009kug.1. mouse. [Q3UL36-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138368 Genomic DNA. No translation available.
BC046971 mRNA. Translation: AAH46971.1 .
AK145733 mRNA. Translation: BAE26615.1 . Sequence problems.
CCDSi CCDS40215.1. [Q3UL36-1 ]
RefSeqi NP_789819.2. NM_176849.3. [Q3UL36-1 ]
UniGenei Mm.251655.

3D structure databases

ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q3UL36.

Proteomic databases

MaxQBi Q3UL36.
PRIDEi Q3UL36.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000048545 ; ENSMUSP00000039493 ; ENSMUSG00000040459 . [Q3UL36-1 ]
GeneIDi 234023.
KEGGi mmu:234023.
UCSCi uc009kug.1. mouse. [Q3UL36-1 ]

Organism-specific databases

CTDi 55082.
MGIi MGI:2442985. Arglu1.

Phylogenomic databases

eggNOGi NOG87986.
GeneTreei ENSGT00730000111249.
HOGENOMi HOG000030700.
HOVERGENi HBG096780.
InParanoidi Q3UL36.
KOi K13173.
OMAi NTDYLIP.
OrthoDBi EOG71CFQN.
PhylomeDBi Q3UL36.
TreeFami TF324123.

Miscellaneous databases

NextBioi 381992.
PROi Q3UL36.
SOURCEi Search...

Gene expression databases

Bgeei Q3UL36.
CleanExi MM_ARGLU1.
Genevestigatori Q3UL36.

Family and domain databases

ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-190.
    Strain: C57BL/6J.
  4. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiARGL1_MOUSE
AccessioniPrimary (citable) accession number: Q3UL36
Secondary accession number(s): Q80XJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: October 29, 2014
This is version 65 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3