Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arginine and glutamate-rich protein 1

Gene

Arglu1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Arginine and glutamate-rich protein 1
Gene namesi
Name:Arglu1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2442985 Arglu1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002884391 – 271Arginine and glutamate-rich protein 1Add BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei58PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei61PhosphothreonineBy similarity1
Modified residuei74PhosphoserineBy similarity1
Modified residuei75PhosphoserineCombined sources1
Modified residuei264PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ3UL36
MaxQBiQ3UL36
PaxDbiQ3UL36
PeptideAtlasiQ3UL36
PRIDEiQ3UL36

PTM databases

iPTMnetiQ3UL36
PhosphoSitePlusiQ3UL36

Expressioni

Gene expression databases

BgeeiENSMUSG00000040459
CleanExiMM_ARGLU1
ExpressionAtlasiQ3UL36 baseline and differential
GenevisibleiQ3UL36 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231486, 2 interactors
IntActiQ3UL36, 2 interactors
STRINGi10090.ENSMUSP00000039493

Structurei

3D structure databases

SMRiQ3UL36
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi3 – 72Arg-richAdd BLAST70
Compositional biasi95 – 249Glu-richAdd BLAST155

Sequence similaritiesi

Belongs to the UPF0430 family.Curated

Phylogenomic databases

eggNOGiENOG410IHEN Eukaryota
ENOG4111J08 LUCA
GeneTreeiENSGT00730000111249
HOGENOMiHOG000030700
HOVERGENiHBG096780
InParanoidiQ3UL36
KOiK13173
OMAiTHTERDY
PhylomeDBiQ3UL36
TreeFamiTF324123

Family and domain databases

InterProiView protein in InterPro
IPR033371 ARGLU1
PANTHERiPTHR31711 PTHR31711, 1 hit
PfamiView protein in Pfam
PF15346 ARGLU, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UL36-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRSRSRSSS RSKHTKSSKH NKKRSRSRSR SRDKERVRKR SKSRESKRNR
60 70 80 90 100
RRESRSRSRS TNAAASRRER ERASSPPDRI DIFGRTVSKR SSLDEKQKRE
110 120 130 140 150
EEEKKAEFER QRKIRQQEIE EKLIEEETAR RVEELVAKRV EEELEKRKDE
160 170 180 190 200
IEREVLRRVE EAKRIMEKQL LEELERQRQA ELAAQKAREE EERAKREELE
210 220 230 240 250
RILEENNRKI AEAQAKLAEE QLRIVEEQRK IHEERMKLEQ ERQRQQKEEQ
260 270
KIILGKGKSR PKLSFSLKTQ D
Length:271
Mass (Da):32,887
Last modified:May 29, 2007 - v2
Checksum:iA17012F236A37340
GO
Isoform 2 (identifier: Q3UL36-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-69: Missing.
     190-271: EEERAKREEL...KLSFSLKTQD → VTLGRLESRDSPWQNFQCQVCLLLSPERDGMRLS

Note: No experimental confirmation available.
Show »
Length:205
Mass (Da):24,796
Checksum:iA268AE0907A7D7BF
GO

Sequence cautioni

The sequence BAE26615 differs from that shown. Chimeric cDNA.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02567552 – 69Missing in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_025676190 – 271EEERA…LKTQD → VTLGRLESRDSPWQNFQCQV CLLLSPERDGMRLS in isoform 2. 1 PublicationAdd BLAST82

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138368 Genomic DNA No translation available.
BC046971 mRNA Translation: AAH46971.1
AK145733 mRNA Translation: BAE26615.1 Sequence problems.
CCDSiCCDS40215.1 [Q3UL36-1]
RefSeqiNP_789819.2, NM_176849.3 [Q3UL36-1]
UniGeneiMm.251655

Genome annotation databases

EnsembliENSMUST00000048545; ENSMUSP00000039493; ENSMUSG00000040459 [Q3UL36-1]
GeneIDi234023
KEGGimmu:234023
UCSCiuc009kug.1 mouse [Q3UL36-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiARGL1_MOUSE
AccessioniPrimary (citable) accession number: Q3UL36
Secondary accession number(s): Q80XJ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: March 28, 2018
This is version 89 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health