Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3UHK6

- TEN4_MOUSE

UniProt

Q3UHK6 - TEN4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Teneurin-4

Gene

Tenm4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer.2 Publications

GO - Molecular functioni

  1. protein homodimerization activity Source: UniProtKB

GO - Biological processi

  1. cardiac cell fate specification Source: MGI
  2. cardiac muscle cell proliferation Source: MGI
  3. central nervous system myelin formation Source: UniProtKB
  4. gastrulation with mouth forming second Source: MGI
  5. neuron development Source: InterPro
  6. positive regulation of gastrulation Source: UniProtKB
  7. positive regulation of myelination Source: UniProtKB
  8. positive regulation of oligodendrocyte differentiation Source: UniProtKB
  9. self proteolysis Source: InterPro
  10. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Teneurin-4
Short name:
Ten-4
Alternative name(s):
Downstream of CHOP4
Protein Odd Oz/ten-m homolog 4
Tenascin-M4
Short name:
Ten-m4
Teneurin transmembrane protein 4
Gene namesi
Name:Tenm4
Synonyms:Doc4, Kiaa1302, Odz4, Tnm4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:2447063. Tenm4.

Subcellular locationi

Membrane 1 Publication; Single-pass membrane protein 1 Publication. Nucleus 1 Publication. Cytoplasm 1 Publication. Cell projection 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 345345CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei346 – 36621HelicalSequence AnalysisAdd
BLAST
Topological domaini367 – 27712405ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. integral component of plasma membrane Source: InterPro
  3. neuron projection Source: UniProtKB
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice show tremors and hypomyelination in the central nervous system (CNS), particularly in the spinal cord, but not in the sciatic nerve of the peripheral nervous system (PNS). Differentiation of oligodendrocytes is prevented in the spinal cord.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 27712771Teneurin-4PRO_0000259509Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi469 – 4691N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi568 ↔ 578PROSITE-ProRule annotation
Disulfide bondi572 ↔ 583PROSITE-ProRule annotation
Disulfide bondi585 ↔ 594PROSITE-ProRule annotation
Disulfide bondi603 ↔ 614PROSITE-ProRule annotation
Disulfide bondi616 ↔ 625PROSITE-ProRule annotation
Disulfide bondi632 ↔ 643PROSITE-ProRule annotation
Disulfide bondi637 ↔ 648PROSITE-ProRule annotation
Disulfide bondi650 ↔ 659PROSITE-ProRule annotation
Disulfide bondi664 ↔ 675PROSITE-ProRule annotation
Disulfide bondi669 ↔ 680PROSITE-ProRule annotation
Disulfide bondi682 ↔ 691PROSITE-ProRule annotation
Disulfide bondi702 ↔ 715PROSITE-ProRule annotation
Disulfide bondi717 ↔ 726PROSITE-ProRule annotation
Disulfide bondi731 ↔ 741PROSITE-ProRule annotation
Disulfide bondi735 ↔ 746PROSITE-ProRule annotation
Disulfide bondi748 ↔ 757PROSITE-ProRule annotation
Disulfide bondi762 ↔ 772PROSITE-ProRule annotation
Disulfide bondi766 ↔ 777PROSITE-ProRule annotation
Disulfide bondi779 ↔ 788PROSITE-ProRule annotation
Disulfide bondi802 ↔ 812PROSITE-ProRule annotation
Disulfide bondi806 ↔ 821PROSITE-ProRule annotation
Disulfide bondi823 ↔ 832PROSITE-ProRule annotation
Glycosylationi942 – 9421N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1261 – 12611N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1611 – 16111N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1707 – 17071N-linked (GlcNAc...)1 Publication
Glycosylationi1743 – 17431N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1801 – 18011N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1886 – 18861N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1987 – 19871N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2190 – 21901N-linked (GlcNAc...)1 Publication
Glycosylationi2330 – 23301N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2648 – 26481N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ3UHK6.
PaxDbiQ3UHK6.
PRIDEiQ3UHK6.

PTM databases

PhosphoSiteiQ3UHK6.

Expressioni

Tissue specificityi

Expressed in brain and spinal cord (at protein level). Expressed in neurons and oligodendrocytes of the spinal cord. Expressed weakly in kidney, lung and spleen. Expressed in the cortex, CA1, CA2 and CA3 of the hippocampus. Expressed in the white matter, Purkinje cells and molecular layer of the cerebellum.3 Publications

Developmental stagei

Expressed in spinal cord at 18 dpc (at protein level). Expressed in the epiblast and extraembryonic regions as early as 6.5 dpc. Expressed in the neural plate and extraembryonic tissues at 7.5 dpc. Expressed in the forebrain, mid/hindbrain junction, somites and tail bud at 8.5 dpc. Expressed in the tail bud and limbs at 11.5 dpc. Expressed in the diencephalon and midbrain at 12.5 dpc.3 Publications

Inductioni

Up-regulated during oligodendrocyte differentiation.1 Publication

Gene expression databases

BgeeiQ3UHK6.
CleanExiMM_ODZ4.
ExpressionAtlasiQ3UHK6. baseline and differential.
GenevestigatoriQ3UHK6.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. May also form heterodimer with either TENM1 or TENM2 or TENM3.

Protein-protein interaction databases

IntActiQ3UHK6. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ3UHK6.
SMRiQ3UHK6. Positions 568-871, 1537-1566.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 341341Teneurin N-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini564 – 59532EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini596 – 62631EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini628 – 66033EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini661 – 69232EGF-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini694 – 72734EGF-like 5PROSITE-ProRule annotationAdd
BLAST
Domaini728 – 75932EGF-like 6PROSITE-ProRule annotationAdd
BLAST
Domaini760 – 78930EGF-like 7PROSITE-ProRule annotationAdd
BLAST
Domaini790 – 83344EGF-like 8PROSITE-ProRule annotationAdd
BLAST
Repeati1218 – 126144NHL 1Add
BLAST
Repeati1266 – 131045NHL 2Add
BLAST
Repeati1336 – 138045NHL 3Add
BLAST
Repeati1395 – 144652NHL 4Add
BLAST
Repeati1525 – 156844NHL 5Add
BLAST
Repeati1578 – 159720YD 1Add
BLAST
Repeati1614 – 163421YD 2Add
BLAST
Repeati1677 – 169620YD 3Add
BLAST
Repeati1697 – 171923YD 4Add
BLAST
Repeati1889 – 190820YD 5Add
BLAST
Repeati1930 – 194819YD 6Add
BLAST
Repeati1949 – 196921YD 7Add
BLAST
Repeati1976 – 199318YD 8Add
BLAST
Repeati1994 – 201522YD 9Add
BLAST
Repeati2016 – 203318YD 10Add
BLAST
Repeati2036 – 205621YD 11Add
BLAST
Repeati2059 – 207921YD 12Add
BLAST
Repeati2087 – 210620YD 13Add
BLAST
Repeati2112 – 212918YD 14Add
BLAST
Repeati2130 – 215627YD 15Add
BLAST
Repeati2158 – 217114YD 16Add
BLAST
Repeati2172 – 219524YD 17Add
BLAST
Repeati2198 – 221821YD 18Add
BLAST
Repeati2219 – 223921YD 19Add
BLAST
Repeati2241 – 226121YD 20Add
BLAST
Repeati2273 – 229321YD 21Add
BLAST
Repeati2295 – 231521YD 22Add
BLAST
Repeati2341 – 238242YD 23Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi179 – 1846Poly-Pro

Domaini

EGF-like domains 2 and 5 which have an odd number of cysteines might enable the formation of intermolecular disulfide bonds.
Cytoplasmic proline-rich regions could serve as docking domains for intracellular SH3-containing proteins.

Sequence similaritiesi

Belongs to the tenascin family. Teneurin subfamily.Curated
Contains 8 EGF-like domains.PROSITE-ProRule annotation
Contains 5 NHL repeats.Curated
Contains 1 teneurin N-terminal domain.PROSITE-ProRule annotation
Contains 23 YD repeats.Curated

Keywords - Domaini

EGF-like domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG323120.
GeneTreeiENSGT00760000119131.
HOGENOMiHOG000231701.
HOVERGENiHBG080306.
InParanoidiQ3UHK6.
OMAiNQFVSQQ.
OrthoDBiEOG7H791C.
PhylomeDBiQ3UHK6.
TreeFamiTF316833.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view]
PANTHERiPTHR11219:SF9. PTHR11219:SF9. 1 hit.
PfamiPF07974. EGF_2. 1 hit.
PF12661. hEGF. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 7 hits.
[Graphical view]
SUPFAMiSSF49464. SSF49464. 1 hit.
TIGRFAMsiTIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEiPS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Additional mRNAs also exist. Tissue-specific expression of isoforms was observed throughout embryogenesis and in the brain and ovary adult tissues.

Isoform 1 (identifier: Q3UHK6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKGPQKSYS SSETLKAYDQ
60 70 80 90 100
DARLAYGSRV KDMVPQEAEE FCRTGTNFTL RELGLGEMTP PHGTLYRTDI
110 120 130 140 150
GLPHCGYSMG ASSDADLEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS
160 170 180 190 200
NLTLTDTEHE NTETDHPSSL QNHPRLRTPP PPLPHAHTPN QHHAASINSL
210 220 230 240 250
NRGNFTPRSN PSPAPTDHSL SGEPPAGSAQ EPTHAQDNWL LNSNIPLETR
260 270 280 290 300
NLGKQPFLGT LQDNLIEMDI LSASRHDGAY SDGHFLFKPG GTSPLFCTTS
310 320 330 340 350
PGYPLTSSTV YSPPPRPLPR STFSRPAFNL KKPSKYCNWK CAALSAILIS
360 370 380 390 400
ATLVILLAYF VAMHLFGLNW HLQPMEGQMQ MYEITEDTAS SWPVPTDVSL
410 420 430 440 450
YPSGGTGLET PDRKGKGAAE GKPSSLFPED SFIDSGEIDV GRRASQKIPP
460 470 480 490 500
GTFWRSQVFI DHPVHLKFNV SLGKAALVGI YGRKGLPPSH TQFDFVELLD
510 520 530 540 550
GRRLLTQEAR SLEGPQRQSR GPVPPSSHET GFIQYLDSGI WHLAFYNDGK
560 570 580 590 600
ESEVVSFLTT AIESVDNCPS NCYGNGDCIS GTCHCFLGFL GPDCGRASCP
610 620 630 640 650
VLCSGNGQYM KGRCLCHSGW KGAECDVPTN QCIDVACSSH GTCIMGTCIC
660 670 680 690 700
NPGYKGESCE EVDCMDPTCS SRGVCVRGEC HCSVGWGGTN CETPRATCLD
710 720 730 740 750
QCSGHGTFLP DTGLCNCDPS WTGHDCSIEI CAADCGGHGV CVGGTCRCED
760 770 780 790 800
GWMGAACDQR ACHPRCAEHG TCRDGKCECS PGWNGEHCTI AHYLDRVVKE
810 820 830 840 850
GCPGLCNGNG RCTLDLNGWH CVCQLGWRGT GCDTSMETGC GDGKDNDGDG
860 870 880 890 900
LVDCMDPDCC LQPLCHVNPL CLGSPDPLDI IQETQAPVSQ QNLNSFYDRI
910 920 930 940 950
KFLVGRDSTH SIPGENPFDG GHACVIRGQV MTSDGTPLVG VNISFINNPL
960 970 980 990 1000
FGYTISRQDG SFDLVTNGGI SIILRFERAP FITQEHTLWL PWDRFFVMET
1010 1020 1030 1040 1050
IVMRHEENEI PSCDLSNFAR PNPVVSPSPL TSFASSCAEK GPIVPEIQAL
1060 1070 1080 1090 1100
QEEIVIAGCK MRLSYLSSRT PGYKSVLRIS LTHPTIPFNL MKVHLMVAVE
1110 1120 1130 1140 1150
GRLFRKWFAA APDLSYYFIW DKTDVYNQKV FGLSEAFVSV GYEYESCPDL
1160 1170 1180 1190 1200
ILWEKRTAVL QGYEIDASKL GGWSLDKHHA LNIQSGILHK GNGENQFVSQ
1210 1220 1230 1240 1250
QPPVIGSIMG NGRRRSISCP SCNGLADGNK LLAPVALTCG SDGSLYVGDF
1260 1270 1280 1290 1300
NYIRRIFPSG NVTNILEMRN KDFRHSHSPA HKYYLATDPM SGAVFLSDTN
1310 1320 1330 1340 1350
SRRVFKVKST TVVKDLVKNS EVVAGTGDQC LPFDDTRCGD GGKATEATLT
1360 1370 1380 1390 1400
NPRGITVDKF GLIYFVDGTM IRRVDQNGII STLLGSNDLT SARPLSCDSV
1410 1420 1430 1440 1450
MEISQVRLEW PTDLAINPMD NSLYVLDNNV VLQISENHQV RIVAGRPMHC
1460 1470 1480 1490 1500
QVPGIDHFLL SKVAIHATLE SATALAVSHN GVLYIAETDE KKINRIRQVT
1510 1520 1530 1540 1550
TSGEISLVAG APSGCDCKND ANCDCFSGDD GYAKDAKLNT PSSLAVCADG
1560 1570 1580 1590 1600
ELYVADLGNI RIRFIRKNKP FLNTQNMYEL SSPIDQELYL FDTSGKHLYT
1610 1620 1630 1640 1650
QSLPTGDYLY NFTYTGDGDI THITDNNGNM VNVRRDSTGM PLWLVVPDGQ
1660 1670 1680 1690 1700
VYWVTMGTNS ALRSVTTQGH ELAMMTYHGN SGLLATKSNE NGWTTFYEYD
1710 1720 1730 1740 1750
SFGRLTNVTF PTGQVSSFRS DTDSSVHVQV ETSSKDDVTI TTNLSASGAF
1760 1770 1780 1790 1800
YTLLQDQVRN SYYIGADGSL RLLLANGMEV ALQTEPHLLA GTVNPTVGKR
1810 1820 1830 1840 1850
NVTLPIDNGL NLVEWRQRKE QARGQVTVFG RRLRVHNRNL LSLDFDRVTR
1860 1870 1880 1890 1900
TEKIYDDHRK FTLRILYDQA GRPSLWSPSS RLNGVNVTYS PGGHIAGIQR
1910 1920 1930 1940 1950
GIMSERMEYD QAGRITSRIF ADGKMWSYTY LEKSMVLHLH SQRQYIFEFD
1960 1970 1980 1990 2000
KNDRLSSVTM PNVARQTLET IRSVGYYRNI YQPPEGNASV IQDFTEDGHL
2010 2020 2030 2040 2050
LHTFYLGTGR RVIYKYGKLS KLAETLYDTT KVSFTYDETA GMLKTVNLQN
2060 2070 2080 2090 2100
EGFTCTIRYR QIGPLIDRQI FRFTEEGMVN ARFDYNYDNS FRVTSMQAVI
2110 2120 2130 2140 2150
NETPLPIDLY RYDDVSGKTE QFGKFGVIYY DINQIITTAV MTHTKHFDAY
2160 2170 2180 2190 2200
GRMKEVQYEI FRSLMYWMTV QYDNMGRVVK KELKVGPYAN TTRYSYEYDA
2210 2220 2230 2240 2250
DGQLQTVSIN DKPLWRYSYD LNGNLHLLSP GNSARLTPLR YDLRDRITRL
2260 2270 2280 2290 2300
GDVQYKMDED GFLRQRGGDV FEYNSAGLLI KAYNRASGWS VRYRYDGLGR
2310 2320 2330 2340 2350
RVSSKSSHSH HLQFFYADLT NPTKVTHLYN HSSSEITSLY YDLQGHLFAM
2360 2370 2380 2390 2400
ELSSGDEFYI ACDNIGTPLA VFSGTGLMIK QILYTAYGEI YMDTNPNFQI
2410 2420 2430 2440 2450
IIGYHGGLYD PLTKLVHMGR RDYDVLAGRW TSPDHELWKR LSSNSIVPFH
2460 2470 2480 2490 2500
LYMFKNNNPI SNSQDIKCFM TDVNSWLLTF GFQLHNVIPG YPKPDTDAME
2510 2520 2530 2540 2550
PSYELVHTQM KTQEWDNSKS ILGVQCEVQK QLKAFVTLER FDQLYGSTIT
2560 2570 2580 2590 2600
SCQQAPETKK FASSGSIFGK GVKFALKDGR VTTDIISVAN EDGRRIAAIL
2610 2620 2630 2640 2650
NNAHYLENLH FTIDGVDTHY FVKPGPSEGD LAILGLSGGR RTLENGVNVT
2660 2670 2680 2690 2700
VSQINTVLSG RTRRYTDIQL QYRALCLNTR YGTTVDEEKV RVLELARQRA
2710 2720 2730 2740 2750
VRQAWAREQQ RLREGEEGLR AWTDGEKQQV LNTGRVQGYD GFFVTSVEQY
2760 2770
PELSDSANNI HFMRQSEMGR R
Length:2,771
Mass (Da):308,425
Last modified:October 31, 2006 - v2
Checksum:i15EF31E25A171FD0
GO
Isoform 2 (identifier: Q3UHK6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     791-799: Missing.
     1269-1275: Missing.

Note: No experimental confirmation available.

Show »
Length:2,825
Mass (Da):313,428
Checksum:i820622CCE037744E
GO
Isoform 3 (identifier: Q3UHK6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     251-283: Missing.

Note: No experimental confirmation available.

Show »
Length:2,833
Mass (Da):314,673
Checksum:i1578D6B6F3E079B1
GO
Isoform 4 (identifier: Q3UHK6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM

Note: No experimental confirmation available.

Show »
Length:2,796
Mass (Da):311,192
Checksum:i70437010F777878E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti136 – 1372TR → EK in BAE36695. (PubMed:16141072)Curated
Sequence conflicti152 – 16413LTLTD…ENTET → EKSGSASLGVAAN in BAE36695. (PubMed:16141072)CuratedAdd
BLAST
Sequence conflicti240 – 2401L → V in AAC31807. (PubMed:9649432)Curated
Sequence conflicti244 – 2441N → K in AAC31807. (PubMed:9649432)Curated
Sequence conflicti247 – 2471L → V in AAC31807. (PubMed:9649432)Curated
Sequence conflicti261 – 2611L → W in AAC31807. (PubMed:9649432)Curated
Sequence conflicti271 – 2711L → F in AAC31807. (PubMed:9649432)Curated
Sequence conflicti276 – 2761H → R in AAC31807. (PubMed:9649432)Curated
Sequence conflicti286 – 2861L → F in AAC31807. (PubMed:9649432)Curated
Sequence conflicti422 – 4298KPSSLFPE → RVAALSVL in BAE36695. (PubMed:16141072)Curated
Sequence conflicti493 – 4931F → L in AAC31807. (PubMed:9649432)Curated
Sequence conflicti780 – 7801S → T in AAC31807. (PubMed:9649432)Curated
Sequence conflicti895 – 8951S → P in BAA77399. (PubMed:10225957)Curated
Sequence conflicti1013 – 10131C → R in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1039 – 10391E → G in BAE28005. (PubMed:16141072)Curated
Sequence conflicti1077 – 10771L → V in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1133 – 11331L → F in BAA77399. (PubMed:10225957)Curated
Sequence conflicti1457 – 14571H → Q in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1743 – 17431N → H in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1746 – 17461A → G in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1831 – 18311R → P in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1875 – 18751L → F in AAC31807. (PubMed:9649432)Curated
Sequence conflicti1952 – 19521N → D in BAE28005. (PubMed:16141072)Curated
Sequence conflicti2144 – 21441T → S in AAC31807. (PubMed:9649432)Curated
Sequence conflicti2160 – 21601I → T in AAC31807. (PubMed:9649432)Curated
Sequence conflicti2256 – 22561K → R in BAE28005. (PubMed:16141072)Curated
Sequence conflicti2262 – 22621F → S in AAC31807. (PubMed:9649432)Curated
Sequence conflicti2330 – 23301N → S in AAC31807. (PubMed:9649432)Curated
Sequence conflicti2657 – 26571V → M in AAC31807. (PubMed:9649432)Curated
Sequence conflicti2657 – 26571V → M in BAA77399. (PubMed:10225957)Curated
Sequence conflicti2657 – 26571V → M in BAC65772. (PubMed:12693553)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEPDHSALSAARAQFVDVEE REPEAM in isoform 3 and isoform 4. 1 PublicationVSP_021404
Alternative sequencei164 – 1641T → TGAPLHCSSASSTPIEQSPS PPPSPPANESQRRLLGNGVA QPTPDSDSEEEFVPNSFLVK SGSASLGVAAN in isoform 2 and isoform 3. 2 PublicationsVSP_021405
Alternative sequencei251 – 28333Missing in isoform 3. 1 PublicationVSP_021406Add
BLAST
Alternative sequencei791 – 7999Missing in isoform 2. 1 PublicationVSP_021407
Alternative sequencei1269 – 12757Missing in isoform 2. 1 PublicationVSP_021408

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059485 mRNA. Translation: AAC31807.1.
AB025413 mRNA. Translation: BAA77399.1.
AK147579 mRNA. Translation: BAE28005.1.
AK147329 mRNA. Translation: BAE27851.1.
AK162046 mRNA. Translation: BAE36695.1.
AK122490 mRNA. Translation: BAC65772.1.
CCDSiCCDS40024.1. [Q3UHK6-4]
PIRiT14271.
RefSeqiNP_035988.2. NM_011858.3. [Q3UHK6-4]
XP_006507872.1. XM_006507809.1. [Q3UHK6-3]
XP_006507873.1. XM_006507810.1. [Q3UHK6-2]
XP_006507874.1. XM_006507811.1. [Q3UHK6-4]
UniGeneiMm.254610.
Mm.391678.

Genome annotation databases

EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078. [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078. [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078. [Q3UHK6-4]
GeneIDi23966.
KEGGimmu:23966.
UCSCiuc009iio.1. mouse. [Q3UHK6-4]
uc009iip.1. mouse. [Q3UHK6-3]
uc009iiq.1. mouse. [Q3UHK6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059485 mRNA. Translation: AAC31807.1 .
AB025413 mRNA. Translation: BAA77399.1 .
AK147579 mRNA. Translation: BAE28005.1 .
AK147329 mRNA. Translation: BAE27851.1 .
AK162046 mRNA. Translation: BAE36695.1 .
AK122490 mRNA. Translation: BAC65772.1 .
CCDSi CCDS40024.1. [Q3UHK6-4 ]
PIRi T14271.
RefSeqi NP_035988.2. NM_011858.3. [Q3UHK6-4 ]
XP_006507872.1. XM_006507809.1. [Q3UHK6-3 ]
XP_006507873.1. XM_006507810.1. [Q3UHK6-2 ]
XP_006507874.1. XM_006507811.1. [Q3UHK6-4 ]
UniGenei Mm.254610.
Mm.391678.

3D structure databases

ProteinModelPortali Q3UHK6.
SMRi Q3UHK6. Positions 568-871, 1537-1566.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q3UHK6. 1 interaction.

PTM databases

PhosphoSitei Q3UHK6.

Proteomic databases

MaxQBi Q3UHK6.
PaxDbi Q3UHK6.
PRIDEi Q3UHK6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000107162 ; ENSMUSP00000102780 ; ENSMUSG00000048078 . [Q3UHK6-2 ]
ENSMUST00000107165 ; ENSMUSP00000102783 ; ENSMUSG00000048078 . [Q3UHK6-3 ]
ENSMUST00000107166 ; ENSMUSP00000102784 ; ENSMUSG00000048078 . [Q3UHK6-4 ]
GeneIDi 23966.
KEGGi mmu:23966.
UCSCi uc009iio.1. mouse. [Q3UHK6-4 ]
uc009iip.1. mouse. [Q3UHK6-3 ]
uc009iiq.1. mouse. [Q3UHK6-2 ]

Organism-specific databases

CTDi 26011.
MGIi MGI:2447063. Tenm4.
Rougei Search...

Phylogenomic databases

eggNOGi NOG323120.
GeneTreei ENSGT00760000119131.
HOGENOMi HOG000231701.
HOVERGENi HBG080306.
InParanoidi Q3UHK6.
OMAi NQFVSQQ.
OrthoDBi EOG7H791C.
PhylomeDBi Q3UHK6.
TreeFami TF316833.

Miscellaneous databases

NextBioi 303833.
PROi Q3UHK6.
SOURCEi Search...

Gene expression databases

Bgeei Q3UHK6.
CleanExi MM_ODZ4.
ExpressionAtlasi Q3UHK6. baseline and differential.
Genevestigatori Q3UHK6.

Family and domain databases

Gene3Di 2.120.10.30. 1 hit.
InterProi IPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view ]
PANTHERi PTHR11219:SF9. PTHR11219:SF9. 1 hit.
Pfami PF07974. EGF_2. 1 hit.
PF12661. hEGF. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view ]
SMARTi SM00181. EGF. 7 hits.
[Graphical view ]
SUPFAMi SSF49464. SSF49464. 1 hit.
TIGRFAMsi TIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEi PS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel stress-induced genes downstream of chop."
    Wang X.-Z., Kuroda M., Sok J., Batchvarova N., Kimmel R., Chung P., Zinszner H., Ron D.
    EMBO J. 17:3619-3630(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: NIH Swiss.
  2. "Mouse ten-m/Odz is a new family of dimeric type II transmembrane proteins expressed in many tissues."
    Oohashi T., Zhou X.-H., Feng K., Richter B., Moergelin M., Perez M.T., Su W.D., Chiquet-Ehrismann R., Rauch U., Faessler R.
    J. Cell Biol. 145:563-577(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Muellerian duct.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-2771.
    Tissue: Brain.
  5. "All four members of the Ten-m/Odz family of transmembrane proteins form dimers."
    Feng K., Zhou X.H., Oohashi T., Morgelin M., Lustig A., Hirakawa S., Ninomiya Y., Engel J., Rauch U., Fassler R.
    J. Biol. Chem. 277:26128-26135(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: HOMODIMERIZATION, HETERODIMERIZATION.
  6. "The murine Ten-m/Odz genes show distinct but overlapping expression patterns during development and in adult brain."
    Zhou X.H., Brandau O., Feng K., Oohashi T., Ninomiya Y., Rauch U., Fassler R.
    Gene Expr. Patterns 3:397-405(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  7. "Mutation of l7Rn3 shows that Odz4 is required for mouse gastrulation."
    Lossie A.C., Nakamura H., Thomas S.E., Justice M.J.
    Genetics 169:285-299(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN GASTRULATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1707 AND ASN-2190.
  9. "Teneurin-4 is a novel regulator of oligodendrocyte differentiation and myelination of small-diameter axons in the CNS."
    Suzuki N., Fukushi M., Kosaki K., Doyle A.D., de Vega S., Yoshizaki K., Akazawa C., Arikawa-Hirasawa E., Yamada Y.
    J. Neurosci. 32:11586-11599(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN OLIGODENDROCYTE DIFFERENTIATION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, INDUCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiTEN4_MOUSE
AccessioniPrimary (citable) accession number: Q3UHK6
Secondary accession number(s): O70465
, Q3TSI0, Q3UH52, Q80TF5, Q9WTS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 26, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3