Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3UHK6

- TEN4_MOUSE

UniProt

Q3UHK6 - TEN4_MOUSE

Protein

Teneurin-4

Gene

Tenm4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 2 (31 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer.2 Publications

    GO - Molecular functioni

    1. protein homodimerization activity Source: UniProtKB

    GO - Biological processi

    1. cardiac cell fate specification Source: MGI
    2. cardiac muscle cell proliferation Source: MGI
    3. central nervous system myelin formation Source: UniProtKB
    4. gastrulation with mouth forming second Source: MGI
    5. neuron development Source: InterPro
    6. positive regulation of gastrulation Source: UniProtKB
    7. positive regulation of myelination Source: UniProtKB
    8. positive regulation of oligodendrocyte differentiation Source: UniProtKB
    9. signal transduction Source: InterPro

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Teneurin-4
    Short name:
    Ten-4
    Alternative name(s):
    Downstream of CHOP4
    Protein Odd Oz/ten-m homolog 4
    Tenascin-M4
    Short name:
    Ten-m4
    Teneurin transmembrane protein 4
    Gene namesi
    Name:Tenm4
    Synonyms:Doc4, Kiaa1302, Odz4, Tnm4
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:2447063. Tenm4.

    Subcellular locationi

    Membrane 1 Publication; Single-pass membrane protein 1 Publication. Nucleus 1 Publication. Cytoplasm 1 Publication. Cell projection 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. integral component of plasma membrane Source: InterPro
    3. neuron projection Source: UniProtKB
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Mice show tremors and hypomyelination in the central nervous system (CNS), particularly in the spinal cord, but not in the sciatic nerve of the peripheral nervous system (PNS). Differentiation of oligodendrocytes is prevented in the spinal cord.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 27712771Teneurin-4PRO_0000259509Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi469 – 4691N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi568 ↔ 578PROSITE-ProRule annotation
    Disulfide bondi572 ↔ 583PROSITE-ProRule annotation
    Disulfide bondi585 ↔ 594PROSITE-ProRule annotation
    Disulfide bondi603 ↔ 614PROSITE-ProRule annotation
    Disulfide bondi616 ↔ 625PROSITE-ProRule annotation
    Disulfide bondi632 ↔ 643PROSITE-ProRule annotation
    Disulfide bondi637 ↔ 648PROSITE-ProRule annotation
    Disulfide bondi650 ↔ 659PROSITE-ProRule annotation
    Disulfide bondi664 ↔ 675PROSITE-ProRule annotation
    Disulfide bondi669 ↔ 680PROSITE-ProRule annotation
    Disulfide bondi682 ↔ 691PROSITE-ProRule annotation
    Disulfide bondi702 ↔ 715PROSITE-ProRule annotation
    Disulfide bondi717 ↔ 726PROSITE-ProRule annotation
    Disulfide bondi731 ↔ 741PROSITE-ProRule annotation
    Disulfide bondi735 ↔ 746PROSITE-ProRule annotation
    Disulfide bondi748 ↔ 757PROSITE-ProRule annotation
    Disulfide bondi762 ↔ 772PROSITE-ProRule annotation
    Disulfide bondi766 ↔ 777PROSITE-ProRule annotation
    Disulfide bondi779 ↔ 788PROSITE-ProRule annotation
    Disulfide bondi802 ↔ 812PROSITE-ProRule annotation
    Disulfide bondi806 ↔ 821PROSITE-ProRule annotation
    Disulfide bondi823 ↔ 832PROSITE-ProRule annotation
    Glycosylationi942 – 9421N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1261 – 12611N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1611 – 16111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1707 – 17071N-linked (GlcNAc...)1 Publication
    Glycosylationi1743 – 17431N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1801 – 18011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1886 – 18861N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1987 – 19871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2190 – 21901N-linked (GlcNAc...)1 Publication
    Glycosylationi2330 – 23301N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2648 – 26481N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ3UHK6.
    PRIDEiQ3UHK6.

    PTM databases

    PhosphoSiteiQ3UHK6.

    Expressioni

    Tissue specificityi

    Expressed in brain and spinal cord (at protein level). Expressed in neurons and oligodendrocytes of the spinal cord. Expressed weakly in kidney, lung and spleen. Expressed in the cortex, CA1, CA2 and CA3 of the hippocampus. Expressed in the white matter, Purkinje cells and molecular layer of the cerebellum.3 Publications

    Developmental stagei

    Expressed in spinal cord at 18 dpc (at protein level). Expressed in the epiblast and extraembryonic regions as early as 6.5 dpc. Expressed in the neural plate and extraembryonic tissues at 7.5 dpc. Expressed in the forebrain, mid/hindbrain junction, somites and tail bud at 8.5 dpc. Expressed in the tail bud and limbs at 11.5 dpc. Expressed in the diencephalon and midbrain at 12.5 dpc.3 Publications

    Inductioni

    Up-regulated during oligodendrocyte differentiation.1 Publication

    Gene expression databases

    ArrayExpressiQ3UHK6.
    BgeeiQ3UHK6.
    CleanExiMM_ODZ4.
    GenevestigatoriQ3UHK6.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked. May also form heterodimer with either TENM1 or TENM2 or TENM3.

    Protein-protein interaction databases

    IntActiQ3UHK6. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ3UHK6.
    SMRiQ3UHK6. Positions 541-871, 1537-1566.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 345345CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini367 – 27712405ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei346 – 36621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 341341Teneurin N-terminalPROSITE-ProRule annotationAdd
    BLAST
    Domaini564 – 59532EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini596 – 62631EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini628 – 66033EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini661 – 69232EGF-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini694 – 72734EGF-like 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini728 – 75932EGF-like 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini760 – 78930EGF-like 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini790 – 83344EGF-like 8PROSITE-ProRule annotationAdd
    BLAST
    Repeati1218 – 126144NHL 1Add
    BLAST
    Repeati1266 – 131045NHL 2Add
    BLAST
    Repeati1336 – 138045NHL 3Add
    BLAST
    Repeati1395 – 144652NHL 4Add
    BLAST
    Repeati1525 – 156844NHL 5Add
    BLAST
    Repeati1578 – 159720YD 1Add
    BLAST
    Repeati1614 – 163421YD 2Add
    BLAST
    Repeati1677 – 169620YD 3Add
    BLAST
    Repeati1697 – 171923YD 4Add
    BLAST
    Repeati1889 – 190820YD 5Add
    BLAST
    Repeati1930 – 194819YD 6Add
    BLAST
    Repeati1949 – 196921YD 7Add
    BLAST
    Repeati1976 – 199318YD 8Add
    BLAST
    Repeati1994 – 201522YD 9Add
    BLAST
    Repeati2016 – 203318YD 10Add
    BLAST
    Repeati2036 – 205621YD 11Add
    BLAST
    Repeati2059 – 207921YD 12Add
    BLAST
    Repeati2087 – 210620YD 13Add
    BLAST
    Repeati2112 – 212918YD 14Add
    BLAST
    Repeati2130 – 215627YD 15Add
    BLAST
    Repeati2158 – 217114YD 16Add
    BLAST
    Repeati2172 – 219524YD 17Add
    BLAST
    Repeati2198 – 221821YD 18Add
    BLAST
    Repeati2219 – 223921YD 19Add
    BLAST
    Repeati2241 – 226121YD 20Add
    BLAST
    Repeati2273 – 229321YD 21Add
    BLAST
    Repeati2295 – 231521YD 22Add
    BLAST
    Repeati2341 – 238242YD 23Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi179 – 1846Poly-Pro

    Domaini

    EGF-like domains 2 and 5 which have an odd number of cysteines might enable the formation of intermolecular disulfide bonds.
    Cytoplasmic proline-rich regions could serve as docking domains for intracellular SH3-containing proteins.

    Sequence similaritiesi

    Belongs to the tenascin family. Teneurin subfamily.Curated
    Contains 8 EGF-like domains.PROSITE-ProRule annotation
    Contains 5 NHL repeats.Curated
    Contains 1 teneurin N-terminal domain.PROSITE-ProRule annotation
    Contains 23 YD repeats.Curated

    Keywords - Domaini

    EGF-like domain, Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG323120.
    GeneTreeiENSGT00660000095277.
    HOGENOMiHOG000231701.
    HOVERGENiHBG080306.
    InParanoidiQ3UHK6.
    OMAiNQFVSQQ.
    OrthoDBiEOG7H791C.
    PhylomeDBiQ3UHK6.
    TreeFamiTF316833.

    Family and domain databases

    Gene3Di2.120.10.30. 1 hit.
    InterProiIPR011042. 6-blade_b-propeller_TolB-like.
    IPR008969. CarboxyPept-like_regulatory.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR013111. EGF_extracell.
    IPR022385. Rhs_assc_core.
    IPR027691. Ten-4.
    IPR009471. Ten_N.
    IPR028916. Tox-GHH_dom.
    IPR006530. YD.
    [Graphical view]
    PANTHERiPTHR11219:SF9. PTHR11219:SF9. 1 hit.
    PfamiPF07974. EGF_2. 1 hit.
    PF12661. hEGF. 1 hit.
    PF05593. RHS_repeat. 1 hit.
    PF06484. Ten_N. 2 hits.
    PF15636. Tox-GHH. 1 hit.
    [Graphical view]
    SMARTiSM00181. EGF. 7 hits.
    [Graphical view]
    SUPFAMiSSF49464. SSF49464. 1 hit.
    TIGRFAMsiTIGR03696. Rhs_assc_core. 1 hit.
    TIGR01643. YD_repeat_2x. 1 hit.
    PROSITEiPS00022. EGF_1. 8 hits.
    PS01186. EGF_2. 7 hits.
    PS50026. EGF_3. 5 hits.
    PS51361. TENEURIN_N. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Additional mRNAs also exist. Tissue-specific expression of isoforms was observed throughout embryogenesis and in the brain and ovary adult tissues.

    Isoform 1 (identifier: Q3UHK6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKGPQKSYS SSETLKAYDQ     50
    DARLAYGSRV KDMVPQEAEE FCRTGTNFTL RELGLGEMTP PHGTLYRTDI 100
    GLPHCGYSMG ASSDADLEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS 150
    NLTLTDTEHE NTETDHPSSL QNHPRLRTPP PPLPHAHTPN QHHAASINSL 200
    NRGNFTPRSN PSPAPTDHSL SGEPPAGSAQ EPTHAQDNWL LNSNIPLETR 250
    NLGKQPFLGT LQDNLIEMDI LSASRHDGAY SDGHFLFKPG GTSPLFCTTS 300
    PGYPLTSSTV YSPPPRPLPR STFSRPAFNL KKPSKYCNWK CAALSAILIS 350
    ATLVILLAYF VAMHLFGLNW HLQPMEGQMQ MYEITEDTAS SWPVPTDVSL 400
    YPSGGTGLET PDRKGKGAAE GKPSSLFPED SFIDSGEIDV GRRASQKIPP 450
    GTFWRSQVFI DHPVHLKFNV SLGKAALVGI YGRKGLPPSH TQFDFVELLD 500
    GRRLLTQEAR SLEGPQRQSR GPVPPSSHET GFIQYLDSGI WHLAFYNDGK 550
    ESEVVSFLTT AIESVDNCPS NCYGNGDCIS GTCHCFLGFL GPDCGRASCP 600
    VLCSGNGQYM KGRCLCHSGW KGAECDVPTN QCIDVACSSH GTCIMGTCIC 650
    NPGYKGESCE EVDCMDPTCS SRGVCVRGEC HCSVGWGGTN CETPRATCLD 700
    QCSGHGTFLP DTGLCNCDPS WTGHDCSIEI CAADCGGHGV CVGGTCRCED 750
    GWMGAACDQR ACHPRCAEHG TCRDGKCECS PGWNGEHCTI AHYLDRVVKE 800
    GCPGLCNGNG RCTLDLNGWH CVCQLGWRGT GCDTSMETGC GDGKDNDGDG 850
    LVDCMDPDCC LQPLCHVNPL CLGSPDPLDI IQETQAPVSQ QNLNSFYDRI 900
    KFLVGRDSTH SIPGENPFDG GHACVIRGQV MTSDGTPLVG VNISFINNPL 950
    FGYTISRQDG SFDLVTNGGI SIILRFERAP FITQEHTLWL PWDRFFVMET 1000
    IVMRHEENEI PSCDLSNFAR PNPVVSPSPL TSFASSCAEK GPIVPEIQAL 1050
    QEEIVIAGCK MRLSYLSSRT PGYKSVLRIS LTHPTIPFNL MKVHLMVAVE 1100
    GRLFRKWFAA APDLSYYFIW DKTDVYNQKV FGLSEAFVSV GYEYESCPDL 1150
    ILWEKRTAVL QGYEIDASKL GGWSLDKHHA LNIQSGILHK GNGENQFVSQ 1200
    QPPVIGSIMG NGRRRSISCP SCNGLADGNK LLAPVALTCG SDGSLYVGDF 1250
    NYIRRIFPSG NVTNILEMRN KDFRHSHSPA HKYYLATDPM SGAVFLSDTN 1300
    SRRVFKVKST TVVKDLVKNS EVVAGTGDQC LPFDDTRCGD GGKATEATLT 1350
    NPRGITVDKF GLIYFVDGTM IRRVDQNGII STLLGSNDLT SARPLSCDSV 1400
    MEISQVRLEW PTDLAINPMD NSLYVLDNNV VLQISENHQV RIVAGRPMHC 1450
    QVPGIDHFLL SKVAIHATLE SATALAVSHN GVLYIAETDE KKINRIRQVT 1500
    TSGEISLVAG APSGCDCKND ANCDCFSGDD GYAKDAKLNT PSSLAVCADG 1550
    ELYVADLGNI RIRFIRKNKP FLNTQNMYEL SSPIDQELYL FDTSGKHLYT 1600
    QSLPTGDYLY NFTYTGDGDI THITDNNGNM VNVRRDSTGM PLWLVVPDGQ 1650
    VYWVTMGTNS ALRSVTTQGH ELAMMTYHGN SGLLATKSNE NGWTTFYEYD 1700
    SFGRLTNVTF PTGQVSSFRS DTDSSVHVQV ETSSKDDVTI TTNLSASGAF 1750
    YTLLQDQVRN SYYIGADGSL RLLLANGMEV ALQTEPHLLA GTVNPTVGKR 1800
    NVTLPIDNGL NLVEWRQRKE QARGQVTVFG RRLRVHNRNL LSLDFDRVTR 1850
    TEKIYDDHRK FTLRILYDQA GRPSLWSPSS RLNGVNVTYS PGGHIAGIQR 1900
    GIMSERMEYD QAGRITSRIF ADGKMWSYTY LEKSMVLHLH SQRQYIFEFD 1950
    KNDRLSSVTM PNVARQTLET IRSVGYYRNI YQPPEGNASV IQDFTEDGHL 2000
    LHTFYLGTGR RVIYKYGKLS KLAETLYDTT KVSFTYDETA GMLKTVNLQN 2050
    EGFTCTIRYR QIGPLIDRQI FRFTEEGMVN ARFDYNYDNS FRVTSMQAVI 2100
    NETPLPIDLY RYDDVSGKTE QFGKFGVIYY DINQIITTAV MTHTKHFDAY 2150
    GRMKEVQYEI FRSLMYWMTV QYDNMGRVVK KELKVGPYAN TTRYSYEYDA 2200
    DGQLQTVSIN DKPLWRYSYD LNGNLHLLSP GNSARLTPLR YDLRDRITRL 2250
    GDVQYKMDED GFLRQRGGDV FEYNSAGLLI KAYNRASGWS VRYRYDGLGR 2300
    RVSSKSSHSH HLQFFYADLT NPTKVTHLYN HSSSEITSLY YDLQGHLFAM 2350
    ELSSGDEFYI ACDNIGTPLA VFSGTGLMIK QILYTAYGEI YMDTNPNFQI 2400
    IIGYHGGLYD PLTKLVHMGR RDYDVLAGRW TSPDHELWKR LSSNSIVPFH 2450
    LYMFKNNNPI SNSQDIKCFM TDVNSWLLTF GFQLHNVIPG YPKPDTDAME 2500
    PSYELVHTQM KTQEWDNSKS ILGVQCEVQK QLKAFVTLER FDQLYGSTIT 2550
    SCQQAPETKK FASSGSIFGK GVKFALKDGR VTTDIISVAN EDGRRIAAIL 2600
    NNAHYLENLH FTIDGVDTHY FVKPGPSEGD LAILGLSGGR RTLENGVNVT 2650
    VSQINTVLSG RTRRYTDIQL QYRALCLNTR YGTTVDEEKV RVLELARQRA 2700
    VRQAWAREQQ RLREGEEGLR AWTDGEKQQV LNTGRVQGYD GFFVTSVEQY 2750
    PELSDSANNI HFMRQSEMGR R 2771
    Length:2,771
    Mass (Da):308,425
    Last modified:October 31, 2006 - v2
    Checksum:i15EF31E25A171FD0
    GO
    Isoform 2 (identifier: Q3UHK6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
         791-799: Missing.
         1269-1275: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,825
    Mass (Da):313,428
    Checksum:i820622CCE037744E
    GO
    Isoform 3 (identifier: Q3UHK6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEPDHSALSAARAQFVDVEEREPEAM
         164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
         251-283: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,833
    Mass (Da):314,673
    Checksum:i1578D6B6F3E079B1
    GO
    Isoform 4 (identifier: Q3UHK6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEPDHSALSAARAQFVDVEEREPEAM

    Note: No experimental confirmation available.

    Show »
    Length:2,796
    Mass (Da):311,192
    Checksum:i70437010F777878E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti136 – 1372TR → EK in BAE36695. (PubMed:16141072)Curated
    Sequence conflicti152 – 16413LTLTD…ENTET → EKSGSASLGVAAN in BAE36695. (PubMed:16141072)CuratedAdd
    BLAST
    Sequence conflicti240 – 2401L → V in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti244 – 2441N → K in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti247 – 2471L → V in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti261 – 2611L → W in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti271 – 2711L → F in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti276 – 2761H → R in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti286 – 2861L → F in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti422 – 4298KPSSLFPE → RVAALSVL in BAE36695. (PubMed:16141072)Curated
    Sequence conflicti493 – 4931F → L in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti780 – 7801S → T in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti895 – 8951S → P in BAA77399. (PubMed:10225957)Curated
    Sequence conflicti1013 – 10131C → R in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1039 – 10391E → G in BAE28005. (PubMed:16141072)Curated
    Sequence conflicti1077 – 10771L → V in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1133 – 11331L → F in BAA77399. (PubMed:10225957)Curated
    Sequence conflicti1457 – 14571H → Q in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1743 – 17431N → H in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1746 – 17461A → G in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1831 – 18311R → P in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1875 – 18751L → F in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti1952 – 19521N → D in BAE28005. (PubMed:16141072)Curated
    Sequence conflicti2144 – 21441T → S in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti2160 – 21601I → T in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti2256 – 22561K → R in BAE28005. (PubMed:16141072)Curated
    Sequence conflicti2262 – 22621F → S in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti2330 – 23301N → S in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti2657 – 26571V → M in AAC31807. (PubMed:9649432)Curated
    Sequence conflicti2657 – 26571V → M in BAA77399. (PubMed:10225957)Curated
    Sequence conflicti2657 – 26571V → M in BAC65772. (PubMed:12693553)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MEPDHSALSAARAQFVDVEE REPEAM in isoform 3 and isoform 4. 1 PublicationVSP_021404
    Alternative sequencei164 – 1641T → TGAPLHCSSASSTPIEQSPS PPPSPPANESQRRLLGNGVA QPTPDSDSEEEFVPNSFLVK SGSASLGVAAN in isoform 2 and isoform 3. 2 PublicationsVSP_021405
    Alternative sequencei251 – 28333Missing in isoform 3. 1 PublicationVSP_021406Add
    BLAST
    Alternative sequencei791 – 7999Missing in isoform 2. 1 PublicationVSP_021407
    Alternative sequencei1269 – 12757Missing in isoform 2. 1 PublicationVSP_021408

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF059485 mRNA. Translation: AAC31807.1.
    AB025413 mRNA. Translation: BAA77399.1.
    AK147579 mRNA. Translation: BAE28005.1.
    AK147329 mRNA. Translation: BAE27851.1.
    AK162046 mRNA. Translation: BAE36695.1.
    AK122490 mRNA. Translation: BAC65772.1.
    CCDSiCCDS40024.1. [Q3UHK6-4]
    PIRiT14271.
    RefSeqiNP_035988.2. NM_011858.3. [Q3UHK6-4]
    XP_006507872.1. XM_006507809.1. [Q3UHK6-3]
    XP_006507873.1. XM_006507810.1. [Q3UHK6-2]
    XP_006507874.1. XM_006507811.1. [Q3UHK6-4]
    UniGeneiMm.254610.
    Mm.391678.

    Genome annotation databases

    EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078. [Q3UHK6-2]
    ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078. [Q3UHK6-3]
    ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078. [Q3UHK6-4]
    GeneIDi23966.
    KEGGimmu:23966.
    UCSCiuc009iio.1. mouse. [Q3UHK6-4]
    uc009iip.1. mouse. [Q3UHK6-3]
    uc009iiq.1. mouse. [Q3UHK6-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF059485 mRNA. Translation: AAC31807.1 .
    AB025413 mRNA. Translation: BAA77399.1 .
    AK147579 mRNA. Translation: BAE28005.1 .
    AK147329 mRNA. Translation: BAE27851.1 .
    AK162046 mRNA. Translation: BAE36695.1 .
    AK122490 mRNA. Translation: BAC65772.1 .
    CCDSi CCDS40024.1. [Q3UHK6-4 ]
    PIRi T14271.
    RefSeqi NP_035988.2. NM_011858.3. [Q3UHK6-4 ]
    XP_006507872.1. XM_006507809.1. [Q3UHK6-3 ]
    XP_006507873.1. XM_006507810.1. [Q3UHK6-2 ]
    XP_006507874.1. XM_006507811.1. [Q3UHK6-4 ]
    UniGenei Mm.254610.
    Mm.391678.

    3D structure databases

    ProteinModelPortali Q3UHK6.
    SMRi Q3UHK6. Positions 541-871, 1537-1566.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q3UHK6. 1 interaction.

    PTM databases

    PhosphoSitei Q3UHK6.

    Proteomic databases

    PaxDbi Q3UHK6.
    PRIDEi Q3UHK6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000107162 ; ENSMUSP00000102780 ; ENSMUSG00000048078 . [Q3UHK6-2 ]
    ENSMUST00000107165 ; ENSMUSP00000102783 ; ENSMUSG00000048078 . [Q3UHK6-3 ]
    ENSMUST00000107166 ; ENSMUSP00000102784 ; ENSMUSG00000048078 . [Q3UHK6-4 ]
    GeneIDi 23966.
    KEGGi mmu:23966.
    UCSCi uc009iio.1. mouse. [Q3UHK6-4 ]
    uc009iip.1. mouse. [Q3UHK6-3 ]
    uc009iiq.1. mouse. [Q3UHK6-2 ]

    Organism-specific databases

    CTDi 26011.
    MGIi MGI:2447063. Tenm4.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG323120.
    GeneTreei ENSGT00660000095277.
    HOGENOMi HOG000231701.
    HOVERGENi HBG080306.
    InParanoidi Q3UHK6.
    OMAi NQFVSQQ.
    OrthoDBi EOG7H791C.
    PhylomeDBi Q3UHK6.
    TreeFami TF316833.

    Miscellaneous databases

    NextBioi 303833.
    PROi Q3UHK6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q3UHK6.
    Bgeei Q3UHK6.
    CleanExi MM_ODZ4.
    Genevestigatori Q3UHK6.

    Family and domain databases

    Gene3Di 2.120.10.30. 1 hit.
    InterProi IPR011042. 6-blade_b-propeller_TolB-like.
    IPR008969. CarboxyPept-like_regulatory.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR013111. EGF_extracell.
    IPR022385. Rhs_assc_core.
    IPR027691. Ten-4.
    IPR009471. Ten_N.
    IPR028916. Tox-GHH_dom.
    IPR006530. YD.
    [Graphical view ]
    PANTHERi PTHR11219:SF9. PTHR11219:SF9. 1 hit.
    Pfami PF07974. EGF_2. 1 hit.
    PF12661. hEGF. 1 hit.
    PF05593. RHS_repeat. 1 hit.
    PF06484. Ten_N. 2 hits.
    PF15636. Tox-GHH. 1 hit.
    [Graphical view ]
    SMARTi SM00181. EGF. 7 hits.
    [Graphical view ]
    SUPFAMi SSF49464. SSF49464. 1 hit.
    TIGRFAMsi TIGR03696. Rhs_assc_core. 1 hit.
    TIGR01643. YD_repeat_2x. 1 hit.
    PROSITEi PS00022. EGF_1. 8 hits.
    PS01186. EGF_2. 7 hits.
    PS50026. EGF_3. 5 hits.
    PS51361. TENEURIN_N. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of novel stress-induced genes downstream of chop."
      Wang X.-Z., Kuroda M., Sok J., Batchvarova N., Kimmel R., Chung P., Zinszner H., Ron D.
      EMBO J. 17:3619-3630(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: NIH Swiss.
    2. "Mouse ten-m/Odz is a new family of dimeric type II transmembrane proteins expressed in many tissues."
      Oohashi T., Zhou X.-H., Feng K., Richter B., Moergelin M., Perez M.T., Su W.D., Chiquet-Ehrismann R., Rauch U., Faessler R.
      J. Cell Biol. 145:563-577(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: BALB/c.
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Muellerian duct.
    4. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-2771.
      Tissue: Brain.
    5. "All four members of the Ten-m/Odz family of transmembrane proteins form dimers."
      Feng K., Zhou X.H., Oohashi T., Morgelin M., Lustig A., Hirakawa S., Ninomiya Y., Engel J., Rauch U., Fassler R.
      J. Biol. Chem. 277:26128-26135(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: HOMODIMERIZATION, HETERODIMERIZATION.
    6. "The murine Ten-m/Odz genes show distinct but overlapping expression patterns during development and in adult brain."
      Zhou X.H., Brandau O., Feng K., Oohashi T., Ninomiya Y., Rauch U., Fassler R.
      Gene Expr. Patterns 3:397-405(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    7. "Mutation of l7Rn3 shows that Odz4 is required for mouse gastrulation."
      Lossie A.C., Nakamura H., Thomas S.E., Justice M.J.
      Genetics 169:285-299(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN GASTRULATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1707 AND ASN-2190.
    9. "Teneurin-4 is a novel regulator of oligodendrocyte differentiation and myelination of small-diameter axons in the CNS."
      Suzuki N., Fukushi M., Kosaki K., Doyle A.D., de Vega S., Yoshizaki K., Akazawa C., Arikawa-Hirasawa E., Yamada Y.
      J. Neurosci. 32:11586-11599(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN OLIGODENDROCYTE DIFFERENTIATION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, INDUCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiTEN4_MOUSE
    AccessioniPrimary (citable) accession number: Q3UHK6
    Secondary accession number(s): O70465
    , Q3TSI0, Q3UH52, Q80TF5, Q9WTS7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: October 31, 2006
    Last modified: October 1, 2014
    This is version 87 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3