SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3UHK6

- TEN4_MOUSE

UniProt

Q3UHK6 - TEN4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Teneurin-4
Gene
Tenm4, Doc4, Kiaa1302, Odz4, Tnm4
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer.2 Publications

GO - Molecular functioni

  1. protein homodimerization activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. cardiac cell fate specification Source: MGI
  2. cardiac muscle cell proliferation Source: MGI
  3. central nervous system myelin formation Source: UniProtKB
  4. gastrulation with mouth forming second Source: MGI
  5. neuron development Source: InterPro
  6. positive regulation of gastrulation Source: UniProtKB
  7. positive regulation of myelination Source: UniProtKB
  8. positive regulation of oligodendrocyte differentiation Source: UniProtKB
  9. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Teneurin-4
Short name:
Ten-4
Alternative name(s):
Downstream of CHOP4
Protein Odd Oz/ten-m homolog 4
Tenascin-M4
Short name:
Ten-m4
Teneurin transmembrane protein 4
Gene namesi
Name:Tenm4
Synonyms:Doc4, Kiaa1302, Odz4, Tnm4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:2447063. Tenm4.

Subcellular locationi

Membrane; Single-pass membrane protein Inferred. Nucleus. Cytoplasm. Cell projection 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 345345Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei346 – 36621Helical; Reviewed prediction
Add
BLAST
Topological domaini367 – 27712405Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. integral component of plasma membrane Source: InterPro
  3. neuron projection Source: UniProtKB
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice show tremors and hypomyelination in the central nervous system (CNS), particularly in the spinal cord, but not in the sciatic nerve of the peripheral nervous system (PNS). Differentiation of oligodendrocytes is prevented in the spinal cord.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 27712771Teneurin-4
PRO_0000259509Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi469 – 4691N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi568 ↔ 578 By similarity
Disulfide bondi572 ↔ 583 By similarity
Disulfide bondi585 ↔ 594 By similarity
Disulfide bondi603 ↔ 614 By similarity
Disulfide bondi616 ↔ 625 By similarity
Disulfide bondi632 ↔ 643 By similarity
Disulfide bondi637 ↔ 648 By similarity
Disulfide bondi650 ↔ 659 By similarity
Disulfide bondi664 ↔ 675 By similarity
Disulfide bondi669 ↔ 680 By similarity
Disulfide bondi682 ↔ 691 By similarity
Disulfide bondi702 ↔ 715 By similarity
Disulfide bondi717 ↔ 726 By similarity
Disulfide bondi731 ↔ 741 By similarity
Disulfide bondi735 ↔ 746 By similarity
Disulfide bondi748 ↔ 757 By similarity
Disulfide bondi762 ↔ 772 By similarity
Disulfide bondi766 ↔ 777 By similarity
Disulfide bondi779 ↔ 788 By similarity
Disulfide bondi802 ↔ 812 By similarity
Disulfide bondi806 ↔ 821 By similarity
Disulfide bondi823 ↔ 832 By similarity
Glycosylationi942 – 9421N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1261 – 12611N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1611 – 16111N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1707 – 17071N-linked (GlcNAc...)1 Publication
Glycosylationi1743 – 17431N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1801 – 18011N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1886 – 18861N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1987 – 19871N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2190 – 21901N-linked (GlcNAc...)1 Publication
Glycosylationi2330 – 23301N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2648 – 26481N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ3UHK6.
PRIDEiQ3UHK6.

PTM databases

PhosphoSiteiQ3UHK6.

Expressioni

Tissue specificityi

Expressed in brain and spinal cord (at protein level). Expressed in neurons and oligodendrocytes of the spinal cord. Expressed weakly in kidney, lung and spleen. Expressed in the cortex, CA1, CA2 and CA3 of the hippocampus. Expressed in the white matter, Purkinje cells and molecular layer of the cerebellum.3 Publications

Developmental stagei

Expressed in spinal cord at 18 dpc (at protein level). Expressed in the epiblast and extraembryonic regions as early as 6.5 dpc. Expressed in the neural plate and extraembryonic tissues at 7.5 dpc. Expressed in the forebrain, mid/hindbrain junction, somites and tail bud at 8.5 dpc. Expressed in the tail bud and limbs at 11.5 dpc. Expressed in the diencephalon and midbrain at 12.5 dpc.3 Publications

Inductioni

Up-regulated during oligodendrocyte differentiation.1 Publication

Gene expression databases

ArrayExpressiQ3UHK6.
BgeeiQ3UHK6.
CleanExiMM_ODZ4.
GenevestigatoriQ3UHK6.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. May also form heterodimer with either TENM1 or TENM2 or TENM3.1 Publication

Protein-protein interaction databases

IntActiQ3UHK6. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ3UHK6.
SMRiQ3UHK6. Positions 541-871, 1537-1566.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 341341Teneurin N-terminal
Add
BLAST
Domaini564 – 59532EGF-like 1
Add
BLAST
Domaini596 – 62631EGF-like 2
Add
BLAST
Domaini628 – 66033EGF-like 3
Add
BLAST
Domaini661 – 69232EGF-like 4
Add
BLAST
Domaini694 – 72734EGF-like 5
Add
BLAST
Domaini728 – 75932EGF-like 6
Add
BLAST
Domaini760 – 78930EGF-like 7
Add
BLAST
Domaini790 – 83344EGF-like 8
Add
BLAST
Repeati1218 – 126144NHL 1
Add
BLAST
Repeati1266 – 131045NHL 2
Add
BLAST
Repeati1336 – 138045NHL 3
Add
BLAST
Repeati1395 – 144652NHL 4
Add
BLAST
Repeati1525 – 156844NHL 5
Add
BLAST
Repeati1578 – 159720YD 1
Add
BLAST
Repeati1614 – 163421YD 2
Add
BLAST
Repeati1677 – 169620YD 3
Add
BLAST
Repeati1697 – 171923YD 4
Add
BLAST
Repeati1889 – 190820YD 5
Add
BLAST
Repeati1930 – 194819YD 6
Add
BLAST
Repeati1949 – 196921YD 7
Add
BLAST
Repeati1976 – 199318YD 8
Add
BLAST
Repeati1994 – 201522YD 9
Add
BLAST
Repeati2016 – 203318YD 10
Add
BLAST
Repeati2036 – 205621YD 11
Add
BLAST
Repeati2059 – 207921YD 12
Add
BLAST
Repeati2087 – 210620YD 13
Add
BLAST
Repeati2112 – 212918YD 14
Add
BLAST
Repeati2130 – 215627YD 15
Add
BLAST
Repeati2158 – 217114YD 16
Add
BLAST
Repeati2172 – 219524YD 17
Add
BLAST
Repeati2198 – 221821YD 18
Add
BLAST
Repeati2219 – 223921YD 19
Add
BLAST
Repeati2241 – 226121YD 20
Add
BLAST
Repeati2273 – 229321YD 21
Add
BLAST
Repeati2295 – 231521YD 22
Add
BLAST
Repeati2341 – 238242YD 23
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi179 – 1846Poly-Pro

Domaini

EGF-like domains 2 and 5 which have an odd number of cysteines might enable the formation of intermolecular disulfide bonds.
Cytoplasmic proline-rich regions could serve as docking domains for intracellular SH3-containing proteins.

Sequence similaritiesi

Contains 8 EGF-like domains.
Contains 5 NHL repeats.
Contains 23 YD repeats.

Keywords - Domaini

EGF-like domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG323120.
GeneTreeiENSGT00660000095277.
HOGENOMiHOG000231701.
HOVERGENiHBG080306.
InParanoidiQ3UHK6.
OMAiNQFVSQQ.
OrthoDBiEOG7H791C.
PhylomeDBiQ3UHK6.
TreeFamiTF316833.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view]
PANTHERiPTHR11219:SF9. PTHR11219:SF9. 1 hit.
PfamiPF07974. EGF_2. 1 hit.
PF12661. hEGF. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 7 hits.
[Graphical view]
SUPFAMiSSF49464. SSF49464. 1 hit.
TIGRFAMsiTIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEiPS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Additional mRNAs also exist. Tissue-specific expression of isoforms was observed throughout embryogenesis and in the brain and ovary adult tissues.

Isoform 1 (identifier: Q3UHK6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKGPQKSYS SSETLKAYDQ     50
DARLAYGSRV KDMVPQEAEE FCRTGTNFTL RELGLGEMTP PHGTLYRTDI 100
GLPHCGYSMG ASSDADLEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS 150
NLTLTDTEHE NTETDHPSSL QNHPRLRTPP PPLPHAHTPN QHHAASINSL 200
NRGNFTPRSN PSPAPTDHSL SGEPPAGSAQ EPTHAQDNWL LNSNIPLETR 250
NLGKQPFLGT LQDNLIEMDI LSASRHDGAY SDGHFLFKPG GTSPLFCTTS 300
PGYPLTSSTV YSPPPRPLPR STFSRPAFNL KKPSKYCNWK CAALSAILIS 350
ATLVILLAYF VAMHLFGLNW HLQPMEGQMQ MYEITEDTAS SWPVPTDVSL 400
YPSGGTGLET PDRKGKGAAE GKPSSLFPED SFIDSGEIDV GRRASQKIPP 450
GTFWRSQVFI DHPVHLKFNV SLGKAALVGI YGRKGLPPSH TQFDFVELLD 500
GRRLLTQEAR SLEGPQRQSR GPVPPSSHET GFIQYLDSGI WHLAFYNDGK 550
ESEVVSFLTT AIESVDNCPS NCYGNGDCIS GTCHCFLGFL GPDCGRASCP 600
VLCSGNGQYM KGRCLCHSGW KGAECDVPTN QCIDVACSSH GTCIMGTCIC 650
NPGYKGESCE EVDCMDPTCS SRGVCVRGEC HCSVGWGGTN CETPRATCLD 700
QCSGHGTFLP DTGLCNCDPS WTGHDCSIEI CAADCGGHGV CVGGTCRCED 750
GWMGAACDQR ACHPRCAEHG TCRDGKCECS PGWNGEHCTI AHYLDRVVKE 800
GCPGLCNGNG RCTLDLNGWH CVCQLGWRGT GCDTSMETGC GDGKDNDGDG 850
LVDCMDPDCC LQPLCHVNPL CLGSPDPLDI IQETQAPVSQ QNLNSFYDRI 900
KFLVGRDSTH SIPGENPFDG GHACVIRGQV MTSDGTPLVG VNISFINNPL 950
FGYTISRQDG SFDLVTNGGI SIILRFERAP FITQEHTLWL PWDRFFVMET 1000
IVMRHEENEI PSCDLSNFAR PNPVVSPSPL TSFASSCAEK GPIVPEIQAL 1050
QEEIVIAGCK MRLSYLSSRT PGYKSVLRIS LTHPTIPFNL MKVHLMVAVE 1100
GRLFRKWFAA APDLSYYFIW DKTDVYNQKV FGLSEAFVSV GYEYESCPDL 1150
ILWEKRTAVL QGYEIDASKL GGWSLDKHHA LNIQSGILHK GNGENQFVSQ 1200
QPPVIGSIMG NGRRRSISCP SCNGLADGNK LLAPVALTCG SDGSLYVGDF 1250
NYIRRIFPSG NVTNILEMRN KDFRHSHSPA HKYYLATDPM SGAVFLSDTN 1300
SRRVFKVKST TVVKDLVKNS EVVAGTGDQC LPFDDTRCGD GGKATEATLT 1350
NPRGITVDKF GLIYFVDGTM IRRVDQNGII STLLGSNDLT SARPLSCDSV 1400
MEISQVRLEW PTDLAINPMD NSLYVLDNNV VLQISENHQV RIVAGRPMHC 1450
QVPGIDHFLL SKVAIHATLE SATALAVSHN GVLYIAETDE KKINRIRQVT 1500
TSGEISLVAG APSGCDCKND ANCDCFSGDD GYAKDAKLNT PSSLAVCADG 1550
ELYVADLGNI RIRFIRKNKP FLNTQNMYEL SSPIDQELYL FDTSGKHLYT 1600
QSLPTGDYLY NFTYTGDGDI THITDNNGNM VNVRRDSTGM PLWLVVPDGQ 1650
VYWVTMGTNS ALRSVTTQGH ELAMMTYHGN SGLLATKSNE NGWTTFYEYD 1700
SFGRLTNVTF PTGQVSSFRS DTDSSVHVQV ETSSKDDVTI TTNLSASGAF 1750
YTLLQDQVRN SYYIGADGSL RLLLANGMEV ALQTEPHLLA GTVNPTVGKR 1800
NVTLPIDNGL NLVEWRQRKE QARGQVTVFG RRLRVHNRNL LSLDFDRVTR 1850
TEKIYDDHRK FTLRILYDQA GRPSLWSPSS RLNGVNVTYS PGGHIAGIQR 1900
GIMSERMEYD QAGRITSRIF ADGKMWSYTY LEKSMVLHLH SQRQYIFEFD 1950
KNDRLSSVTM PNVARQTLET IRSVGYYRNI YQPPEGNASV IQDFTEDGHL 2000
LHTFYLGTGR RVIYKYGKLS KLAETLYDTT KVSFTYDETA GMLKTVNLQN 2050
EGFTCTIRYR QIGPLIDRQI FRFTEEGMVN ARFDYNYDNS FRVTSMQAVI 2100
NETPLPIDLY RYDDVSGKTE QFGKFGVIYY DINQIITTAV MTHTKHFDAY 2150
GRMKEVQYEI FRSLMYWMTV QYDNMGRVVK KELKVGPYAN TTRYSYEYDA 2200
DGQLQTVSIN DKPLWRYSYD LNGNLHLLSP GNSARLTPLR YDLRDRITRL 2250
GDVQYKMDED GFLRQRGGDV FEYNSAGLLI KAYNRASGWS VRYRYDGLGR 2300
RVSSKSSHSH HLQFFYADLT NPTKVTHLYN HSSSEITSLY YDLQGHLFAM 2350
ELSSGDEFYI ACDNIGTPLA VFSGTGLMIK QILYTAYGEI YMDTNPNFQI 2400
IIGYHGGLYD PLTKLVHMGR RDYDVLAGRW TSPDHELWKR LSSNSIVPFH 2450
LYMFKNNNPI SNSQDIKCFM TDVNSWLLTF GFQLHNVIPG YPKPDTDAME 2500
PSYELVHTQM KTQEWDNSKS ILGVQCEVQK QLKAFVTLER FDQLYGSTIT 2550
SCQQAPETKK FASSGSIFGK GVKFALKDGR VTTDIISVAN EDGRRIAAIL 2600
NNAHYLENLH FTIDGVDTHY FVKPGPSEGD LAILGLSGGR RTLENGVNVT 2650
VSQINTVLSG RTRRYTDIQL QYRALCLNTR YGTTVDEEKV RVLELARQRA 2700
VRQAWAREQQ RLREGEEGLR AWTDGEKQQV LNTGRVQGYD GFFVTSVEQY 2750
PELSDSANNI HFMRQSEMGR R 2771
Length:2,771
Mass (Da):308,425
Last modified:October 31, 2006 - v2
Checksum:i15EF31E25A171FD0
GO
Isoform 2 (identifier: Q3UHK6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     791-799: Missing.
     1269-1275: Missing.

Note: No experimental confirmation available.

Show »
Length:2,825
Mass (Da):313,428
Checksum:i820622CCE037744E
GO
Isoform 3 (identifier: Q3UHK6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     251-283: Missing.

Note: No experimental confirmation available.

Show »
Length:2,833
Mass (Da):314,673
Checksum:i1578D6B6F3E079B1
GO
Isoform 4 (identifier: Q3UHK6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM

Note: No experimental confirmation available.

Show »
Length:2,796
Mass (Da):311,192
Checksum:i70437010F777878E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEPDHSALSAARAQFVDVEE REPEAM in isoform 3 and isoform 4.
VSP_021404
Alternative sequencei164 – 1641T → TGAPLHCSSASSTPIEQSPS PPPSPPANESQRRLLGNGVA QPTPDSDSEEEFVPNSFLVK SGSASLGVAAN in isoform 2 and isoform 3.
VSP_021405
Alternative sequencei251 – 28333Missing in isoform 3.
VSP_021406Add
BLAST
Alternative sequencei791 – 7999Missing in isoform 2.
VSP_021407
Alternative sequencei1269 – 12757Missing in isoform 2.
VSP_021408

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti136 – 1372TR → EK in BAE36695. 1 Publication
Sequence conflicti152 – 16413LTLTD…ENTET → EKSGSASLGVAAN in BAE36695. 1 Publication
Add
BLAST
Sequence conflicti240 – 2401L → V in AAC31807. 1 Publication
Sequence conflicti244 – 2441N → K in AAC31807. 1 Publication
Sequence conflicti247 – 2471L → V in AAC31807. 1 Publication
Sequence conflicti261 – 2611L → W in AAC31807. 1 Publication
Sequence conflicti271 – 2711L → F in AAC31807. 1 Publication
Sequence conflicti276 – 2761H → R in AAC31807. 1 Publication
Sequence conflicti286 – 2861L → F in AAC31807. 1 Publication
Sequence conflicti422 – 4298KPSSLFPE → RVAALSVL in BAE36695. 1 Publication
Sequence conflicti493 – 4931F → L in AAC31807. 1 Publication
Sequence conflicti780 – 7801S → T in AAC31807. 1 Publication
Sequence conflicti895 – 8951S → P in BAA77399. 1 Publication
Sequence conflicti1013 – 10131C → R in AAC31807. 1 Publication
Sequence conflicti1039 – 10391E → G in BAE28005. 1 Publication
Sequence conflicti1077 – 10771L → V in AAC31807. 1 Publication
Sequence conflicti1133 – 11331L → F in BAA77399. 1 Publication
Sequence conflicti1457 – 14571H → Q in AAC31807. 1 Publication
Sequence conflicti1743 – 17431N → H in AAC31807. 1 Publication
Sequence conflicti1746 – 17461A → G in AAC31807. 1 Publication
Sequence conflicti1831 – 18311R → P in AAC31807. 1 Publication
Sequence conflicti1875 – 18751L → F in AAC31807. 1 Publication
Sequence conflicti1952 – 19521N → D in BAE28005. 1 Publication
Sequence conflicti2144 – 21441T → S in AAC31807. 1 Publication
Sequence conflicti2160 – 21601I → T in AAC31807. 1 Publication
Sequence conflicti2256 – 22561K → R in BAE28005. 1 Publication
Sequence conflicti2262 – 22621F → S in AAC31807. 1 Publication
Sequence conflicti2330 – 23301N → S in AAC31807. 1 Publication
Sequence conflicti2657 – 26571V → M in AAC31807. 1 Publication
Sequence conflicti2657 – 26571V → M in BAA77399. 1 Publication
Sequence conflicti2657 – 26571V → M in BAC65772. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF059485 mRNA. Translation: AAC31807.1.
AB025413 mRNA. Translation: BAA77399.1.
AK147579 mRNA. Translation: BAE28005.1.
AK147329 mRNA. Translation: BAE27851.1.
AK162046 mRNA. Translation: BAE36695.1.
AK122490 mRNA. Translation: BAC65772.1.
CCDSiCCDS40024.1. [Q3UHK6-4]
PIRiT14271.
RefSeqiNP_035988.2. NM_011858.3. [Q3UHK6-4]
XP_006507872.1. XM_006507809.1. [Q3UHK6-3]
XP_006507873.1. XM_006507810.1. [Q3UHK6-2]
XP_006507874.1. XM_006507811.1. [Q3UHK6-4]
UniGeneiMm.254610.
Mm.391678.

Genome annotation databases

EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078. [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078. [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078. [Q3UHK6-4]
GeneIDi23966.
KEGGimmu:23966.
UCSCiuc009iio.1. mouse. [Q3UHK6-4]
uc009iip.1. mouse. [Q3UHK6-3]
uc009iiq.1. mouse. [Q3UHK6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF059485 mRNA. Translation: AAC31807.1 .
AB025413 mRNA. Translation: BAA77399.1 .
AK147579 mRNA. Translation: BAE28005.1 .
AK147329 mRNA. Translation: BAE27851.1 .
AK162046 mRNA. Translation: BAE36695.1 .
AK122490 mRNA. Translation: BAC65772.1 .
CCDSi CCDS40024.1. [Q3UHK6-4 ]
PIRi T14271.
RefSeqi NP_035988.2. NM_011858.3. [Q3UHK6-4 ]
XP_006507872.1. XM_006507809.1. [Q3UHK6-3 ]
XP_006507873.1. XM_006507810.1. [Q3UHK6-2 ]
XP_006507874.1. XM_006507811.1. [Q3UHK6-4 ]
UniGenei Mm.254610.
Mm.391678.

3D structure databases

ProteinModelPortali Q3UHK6.
SMRi Q3UHK6. Positions 541-871, 1537-1566.
ModBasei Search...

Protein-protein interaction databases

IntActi Q3UHK6. 1 interaction.

PTM databases

PhosphoSitei Q3UHK6.

Proteomic databases

PaxDbi Q3UHK6.
PRIDEi Q3UHK6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000107162 ; ENSMUSP00000102780 ; ENSMUSG00000048078 . [Q3UHK6-2 ]
ENSMUST00000107165 ; ENSMUSP00000102783 ; ENSMUSG00000048078 . [Q3UHK6-3 ]
ENSMUST00000107166 ; ENSMUSP00000102784 ; ENSMUSG00000048078 . [Q3UHK6-4 ]
GeneIDi 23966.
KEGGi mmu:23966.
UCSCi uc009iio.1. mouse. [Q3UHK6-4 ]
uc009iip.1. mouse. [Q3UHK6-3 ]
uc009iiq.1. mouse. [Q3UHK6-2 ]

Organism-specific databases

CTDi 26011.
MGIi MGI:2447063. Tenm4.
Rougei Search...

Phylogenomic databases

eggNOGi NOG323120.
GeneTreei ENSGT00660000095277.
HOGENOMi HOG000231701.
HOVERGENi HBG080306.
InParanoidi Q3UHK6.
OMAi NQFVSQQ.
OrthoDBi EOG7H791C.
PhylomeDBi Q3UHK6.
TreeFami TF316833.

Miscellaneous databases

NextBioi 303833.
PROi Q3UHK6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q3UHK6.
Bgeei Q3UHK6.
CleanExi MM_ODZ4.
Genevestigatori Q3UHK6.

Family and domain databases

Gene3Di 2.120.10.30. 1 hit.
InterProi IPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view ]
PANTHERi PTHR11219:SF9. PTHR11219:SF9. 1 hit.
Pfami PF07974. EGF_2. 1 hit.
PF12661. hEGF. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view ]
SMARTi SM00181. EGF. 7 hits.
[Graphical view ]
SUPFAMi SSF49464. SSF49464. 1 hit.
TIGRFAMsi TIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEi PS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel stress-induced genes downstream of chop."
    Wang X.-Z., Kuroda M., Sok J., Batchvarova N., Kimmel R., Chung P., Zinszner H., Ron D.
    EMBO J. 17:3619-3630(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: NIH Swiss.
  2. "Mouse ten-m/Odz is a new family of dimeric type II transmembrane proteins expressed in many tissues."
    Oohashi T., Zhou X.-H., Feng K., Richter B., Moergelin M., Perez M.T., Su W.D., Chiquet-Ehrismann R., Rauch U., Faessler R.
    J. Cell Biol. 145:563-577(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Muellerian duct.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-2771.
    Tissue: Brain.
  5. "All four members of the Ten-m/Odz family of transmembrane proteins form dimers."
    Feng K., Zhou X.H., Oohashi T., Morgelin M., Lustig A., Hirakawa S., Ninomiya Y., Engel J., Rauch U., Fassler R.
    J. Biol. Chem. 277:26128-26135(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: HOMODIMERIZATION, HETERODIMERIZATION.
  6. "The murine Ten-m/Odz genes show distinct but overlapping expression patterns during development and in adult brain."
    Zhou X.H., Brandau O., Feng K., Oohashi T., Ninomiya Y., Rauch U., Fassler R.
    Gene Expr. Patterns 3:397-405(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  7. "Mutation of l7Rn3 shows that Odz4 is required for mouse gastrulation."
    Lossie A.C., Nakamura H., Thomas S.E., Justice M.J.
    Genetics 169:285-299(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN GASTRULATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1707 AND ASN-2190.
  9. "Teneurin-4 is a novel regulator of oligodendrocyte differentiation and myelination of small-diameter axons in the CNS."
    Suzuki N., Fukushi M., Kosaki K., Doyle A.D., de Vega S., Yoshizaki K., Akazawa C., Arikawa-Hirasawa E., Yamada Y.
    J. Neurosci. 32:11586-11599(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN OLIGODENDROCYTE DIFFERENTIATION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, INDUCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiTEN4_MOUSE
AccessioniPrimary (citable) accession number: Q3UHK6
Secondary accession number(s): O70465
, Q3TSI0, Q3UH52, Q80TF5, Q9WTS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi