Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Teneurin-4

Gene

Tenm4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer.2 Publications

GO - Molecular functioni

GO - Biological processi

  • cardiac cell fate specification Source: MGI
  • cardiac muscle cell proliferation Source: MGI
  • cell morphogenesis Source: GO_Central
  • central nervous system myelin formation Source: UniProtKB
  • gastrulation with mouth forming second Source: MGI
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: GO_Central
  • neuron development Source: UniProtKB
  • positive regulation of gastrulation Source: UniProtKB
  • positive regulation of myelination Source: UniProtKB
  • positive regulation of oligodendrocyte differentiation Source: UniProtKB
  • regulation of myelination Source: UniProtKB
  • self proteolysis Source: InterPro
  • signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Teneurin-4
Short name:
Ten-4
Alternative name(s):
Downstream of CHOP4
Protein Odd Oz/ten-m homolog 4
Tenascin-M4
Short name:
Ten-m4
Teneurin transmembrane protein 4
Gene namesi
Name:Tenm4
Synonyms:Doc4, Kiaa1302, Odz4, Tnm4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2447063. Tenm4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 345CytoplasmicSequence analysisAdd BLAST345
Transmembranei346 – 366HelicalSequence analysisAdd BLAST21
Topological domaini367 – 2771ExtracellularSequence analysisAdd BLAST2405

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • integral component of plasma membrane Source: GO_Central
  • neuron projection Source: UniProtKB
  • nucleus Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice show tremors and hypomyelination in the central nervous system (CNS), particularly in the spinal cord, but not in the sciatic nerve of the peripheral nervous system (PNS). Differentiation of oligodendrocytes is prevented in the spinal cord.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002595091 – 2771Teneurin-4Add BLAST2771

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei124PhosphoserineCombined sources1
Modified residuei178PhosphothreonineCombined sources1
Glycosylationi469N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi568 ↔ 578PROSITE-ProRule annotation
Disulfide bondi572 ↔ 583PROSITE-ProRule annotation
Disulfide bondi585 ↔ 594PROSITE-ProRule annotation
Disulfide bondi603 ↔ 614PROSITE-ProRule annotation
Disulfide bondi616 ↔ 625PROSITE-ProRule annotation
Disulfide bondi632 ↔ 643PROSITE-ProRule annotation
Disulfide bondi637 ↔ 648PROSITE-ProRule annotation
Disulfide bondi650 ↔ 659PROSITE-ProRule annotation
Disulfide bondi664 ↔ 675PROSITE-ProRule annotation
Disulfide bondi669 ↔ 680PROSITE-ProRule annotation
Disulfide bondi682 ↔ 691PROSITE-ProRule annotation
Disulfide bondi702 ↔ 715PROSITE-ProRule annotation
Disulfide bondi717 ↔ 726PROSITE-ProRule annotation
Disulfide bondi731 ↔ 741PROSITE-ProRule annotation
Disulfide bondi735 ↔ 746PROSITE-ProRule annotation
Disulfide bondi748 ↔ 757PROSITE-ProRule annotation
Disulfide bondi762 ↔ 772PROSITE-ProRule annotation
Disulfide bondi766 ↔ 777PROSITE-ProRule annotation
Disulfide bondi779 ↔ 788PROSITE-ProRule annotation
Disulfide bondi802 ↔ 812PROSITE-ProRule annotation
Disulfide bondi806 ↔ 821PROSITE-ProRule annotation
Disulfide bondi823 ↔ 832PROSITE-ProRule annotation
Glycosylationi942N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1261N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1611N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1707N-linked (GlcNAc...)1 Publication1
Glycosylationi1743N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1801N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1886N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1987N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2190N-linked (GlcNAc...)1 Publication1
Glycosylationi2330N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2648N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ3UHK6.
PaxDbiQ3UHK6.
PeptideAtlasiQ3UHK6.
PRIDEiQ3UHK6.

PTM databases

iPTMnetiQ3UHK6.
PhosphoSitePlusiQ3UHK6.

Expressioni

Tissue specificityi

Expressed in brain and spinal cord (at protein level). Expressed in neurons and oligodendrocytes of the spinal cord. Expressed weakly in kidney, lung and spleen. Expressed in the cortex, CA1, CA2 and CA3 of the hippocampus. Expressed in the white matter, Purkinje cells and molecular layer of the cerebellum.3 Publications

Developmental stagei

Expressed in spinal cord at 18 dpc (at protein level). Expressed in the epiblast and extraembryonic regions as early as 6.5 dpc. Expressed in the neural plate and extraembryonic tissues at 7.5 dpc. Expressed in the forebrain, mid/hindbrain junction, somites and tail bud at 8.5 dpc. Expressed in the tail bud and limbs at 11.5 dpc. Expressed in the diencephalon and midbrain at 12.5 dpc.3 Publications

Inductioni

Up-regulated during oligodendrocyte differentiation.1 Publication

Gene expression databases

BgeeiENSMUSG00000048078.
CleanExiMM_ODZ4.
ExpressionAtlasiQ3UHK6. baseline and differential.
GenevisibleiQ3UHK6. MM.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. May also form heterodimer with either TENM1 or TENM2 or TENM3.

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ3UHK6. 1 interactor.
STRINGi10090.ENSMUSP00000102784.

Structurei

3D structure databases

ProteinModelPortaliQ3UHK6.
SMRiQ3UHK6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 341Teneurin N-terminalPROSITE-ProRule annotationAdd BLAST341
Domaini564 – 595EGF-like 1PROSITE-ProRule annotationAdd BLAST32
Domaini596 – 626EGF-like 2PROSITE-ProRule annotationAdd BLAST31
Domaini628 – 660EGF-like 3PROSITE-ProRule annotationAdd BLAST33
Domaini661 – 692EGF-like 4PROSITE-ProRule annotationAdd BLAST32
Domaini694 – 727EGF-like 5PROSITE-ProRule annotationAdd BLAST34
Domaini728 – 759EGF-like 6PROSITE-ProRule annotationAdd BLAST32
Domaini760 – 789EGF-like 7PROSITE-ProRule annotationAdd BLAST30
Domaini790 – 833EGF-like 8PROSITE-ProRule annotationAdd BLAST44
Repeati1218 – 1261NHL 1Add BLAST44
Repeati1266 – 1310NHL 2Add BLAST45
Repeati1336 – 1380NHL 3Add BLAST45
Repeati1395 – 1446NHL 4Add BLAST52
Repeati1525 – 1568NHL 5Add BLAST44
Repeati1578 – 1597YD 1Add BLAST20
Repeati1614 – 1634YD 2Add BLAST21
Repeati1677 – 1696YD 3Add BLAST20
Repeati1697 – 1719YD 4Add BLAST23
Repeati1889 – 1908YD 5Add BLAST20
Repeati1930 – 1948YD 6Add BLAST19
Repeati1949 – 1969YD 7Add BLAST21
Repeati1976 – 1993YD 8Add BLAST18
Repeati1994 – 2015YD 9Add BLAST22
Repeati2016 – 2033YD 10Add BLAST18
Repeati2036 – 2056YD 11Add BLAST21
Repeati2059 – 2079YD 12Add BLAST21
Repeati2087 – 2106YD 13Add BLAST20
Repeati2112 – 2129YD 14Add BLAST18
Repeati2130 – 2156YD 15Add BLAST27
Repeati2158 – 2171YD 16Add BLAST14
Repeati2172 – 2195YD 17Add BLAST24
Repeati2198 – 2218YD 18Add BLAST21
Repeati2219 – 2239YD 19Add BLAST21
Repeati2241 – 2261YD 20Add BLAST21
Repeati2273 – 2293YD 21Add BLAST21
Repeati2295 – 2315YD 22Add BLAST21
Repeati2341 – 2382YD 23Add BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi179 – 184Poly-Pro6

Domaini

EGF-like domains 2 and 5 which have an odd number of cysteines might enable the formation of intermolecular disulfide bonds.
Cytoplasmic proline-rich regions could serve as docking domains for intracellular SH3-containing proteins.

Sequence similaritiesi

Belongs to the tenascin family. Teneurin subfamily.Curated
Contains 8 EGF-like domains.PROSITE-ProRule annotation
Contains 5 NHL repeats.Curated
Contains 1 teneurin N-terminal domain.PROSITE-ProRule annotation
Contains 23 YD repeats.Curated

Keywords - Domaini

EGF-like domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410KDN2. Eukaryota.
ENOG410Z5H4. LUCA.
GeneTreeiENSGT00760000119131.
HOGENOMiHOG000231701.
HOVERGENiHBG080306.
InParanoidiQ3UHK6.
OMAiYEVSSPI.
OrthoDBiEOG091G02H3.
PhylomeDBiQ3UHK6.
TreeFamiTF316833.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR031325. RHS_repeat.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view]
PANTHERiPTHR11219:SF9. PTHR11219:SF9. 2 hits.
PfamiPF07974. EGF_2. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 8 hits.
[Graphical view]
SUPFAMiSSF49464. SSF49464. 1 hit.
TIGRFAMsiTIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEiPS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional mRNAs also exist. Tissue-specific expression of isoforms was observed throughout embryogenesis and in the brain and ovary adult tissues.
Isoform 1 (identifier: Q3UHK6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKGPQKSYS SSETLKAYDQ
60 70 80 90 100
DARLAYGSRV KDMVPQEAEE FCRTGTNFTL RELGLGEMTP PHGTLYRTDI
110 120 130 140 150
GLPHCGYSMG ASSDADLEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS
160 170 180 190 200
NLTLTDTEHE NTETDHPSSL QNHPRLRTPP PPLPHAHTPN QHHAASINSL
210 220 230 240 250
NRGNFTPRSN PSPAPTDHSL SGEPPAGSAQ EPTHAQDNWL LNSNIPLETR
260 270 280 290 300
NLGKQPFLGT LQDNLIEMDI LSASRHDGAY SDGHFLFKPG GTSPLFCTTS
310 320 330 340 350
PGYPLTSSTV YSPPPRPLPR STFSRPAFNL KKPSKYCNWK CAALSAILIS
360 370 380 390 400
ATLVILLAYF VAMHLFGLNW HLQPMEGQMQ MYEITEDTAS SWPVPTDVSL
410 420 430 440 450
YPSGGTGLET PDRKGKGAAE GKPSSLFPED SFIDSGEIDV GRRASQKIPP
460 470 480 490 500
GTFWRSQVFI DHPVHLKFNV SLGKAALVGI YGRKGLPPSH TQFDFVELLD
510 520 530 540 550
GRRLLTQEAR SLEGPQRQSR GPVPPSSHET GFIQYLDSGI WHLAFYNDGK
560 570 580 590 600
ESEVVSFLTT AIESVDNCPS NCYGNGDCIS GTCHCFLGFL GPDCGRASCP
610 620 630 640 650
VLCSGNGQYM KGRCLCHSGW KGAECDVPTN QCIDVACSSH GTCIMGTCIC
660 670 680 690 700
NPGYKGESCE EVDCMDPTCS SRGVCVRGEC HCSVGWGGTN CETPRATCLD
710 720 730 740 750
QCSGHGTFLP DTGLCNCDPS WTGHDCSIEI CAADCGGHGV CVGGTCRCED
760 770 780 790 800
GWMGAACDQR ACHPRCAEHG TCRDGKCECS PGWNGEHCTI AHYLDRVVKE
810 820 830 840 850
GCPGLCNGNG RCTLDLNGWH CVCQLGWRGT GCDTSMETGC GDGKDNDGDG
860 870 880 890 900
LVDCMDPDCC LQPLCHVNPL CLGSPDPLDI IQETQAPVSQ QNLNSFYDRI
910 920 930 940 950
KFLVGRDSTH SIPGENPFDG GHACVIRGQV MTSDGTPLVG VNISFINNPL
960 970 980 990 1000
FGYTISRQDG SFDLVTNGGI SIILRFERAP FITQEHTLWL PWDRFFVMET
1010 1020 1030 1040 1050
IVMRHEENEI PSCDLSNFAR PNPVVSPSPL TSFASSCAEK GPIVPEIQAL
1060 1070 1080 1090 1100
QEEIVIAGCK MRLSYLSSRT PGYKSVLRIS LTHPTIPFNL MKVHLMVAVE
1110 1120 1130 1140 1150
GRLFRKWFAA APDLSYYFIW DKTDVYNQKV FGLSEAFVSV GYEYESCPDL
1160 1170 1180 1190 1200
ILWEKRTAVL QGYEIDASKL GGWSLDKHHA LNIQSGILHK GNGENQFVSQ
1210 1220 1230 1240 1250
QPPVIGSIMG NGRRRSISCP SCNGLADGNK LLAPVALTCG SDGSLYVGDF
1260 1270 1280 1290 1300
NYIRRIFPSG NVTNILEMRN KDFRHSHSPA HKYYLATDPM SGAVFLSDTN
1310 1320 1330 1340 1350
SRRVFKVKST TVVKDLVKNS EVVAGTGDQC LPFDDTRCGD GGKATEATLT
1360 1370 1380 1390 1400
NPRGITVDKF GLIYFVDGTM IRRVDQNGII STLLGSNDLT SARPLSCDSV
1410 1420 1430 1440 1450
MEISQVRLEW PTDLAINPMD NSLYVLDNNV VLQISENHQV RIVAGRPMHC
1460 1470 1480 1490 1500
QVPGIDHFLL SKVAIHATLE SATALAVSHN GVLYIAETDE KKINRIRQVT
1510 1520 1530 1540 1550
TSGEISLVAG APSGCDCKND ANCDCFSGDD GYAKDAKLNT PSSLAVCADG
1560 1570 1580 1590 1600
ELYVADLGNI RIRFIRKNKP FLNTQNMYEL SSPIDQELYL FDTSGKHLYT
1610 1620 1630 1640 1650
QSLPTGDYLY NFTYTGDGDI THITDNNGNM VNVRRDSTGM PLWLVVPDGQ
1660 1670 1680 1690 1700
VYWVTMGTNS ALRSVTTQGH ELAMMTYHGN SGLLATKSNE NGWTTFYEYD
1710 1720 1730 1740 1750
SFGRLTNVTF PTGQVSSFRS DTDSSVHVQV ETSSKDDVTI TTNLSASGAF
1760 1770 1780 1790 1800
YTLLQDQVRN SYYIGADGSL RLLLANGMEV ALQTEPHLLA GTVNPTVGKR
1810 1820 1830 1840 1850
NVTLPIDNGL NLVEWRQRKE QARGQVTVFG RRLRVHNRNL LSLDFDRVTR
1860 1870 1880 1890 1900
TEKIYDDHRK FTLRILYDQA GRPSLWSPSS RLNGVNVTYS PGGHIAGIQR
1910 1920 1930 1940 1950
GIMSERMEYD QAGRITSRIF ADGKMWSYTY LEKSMVLHLH SQRQYIFEFD
1960 1970 1980 1990 2000
KNDRLSSVTM PNVARQTLET IRSVGYYRNI YQPPEGNASV IQDFTEDGHL
2010 2020 2030 2040 2050
LHTFYLGTGR RVIYKYGKLS KLAETLYDTT KVSFTYDETA GMLKTVNLQN
2060 2070 2080 2090 2100
EGFTCTIRYR QIGPLIDRQI FRFTEEGMVN ARFDYNYDNS FRVTSMQAVI
2110 2120 2130 2140 2150
NETPLPIDLY RYDDVSGKTE QFGKFGVIYY DINQIITTAV MTHTKHFDAY
2160 2170 2180 2190 2200
GRMKEVQYEI FRSLMYWMTV QYDNMGRVVK KELKVGPYAN TTRYSYEYDA
2210 2220 2230 2240 2250
DGQLQTVSIN DKPLWRYSYD LNGNLHLLSP GNSARLTPLR YDLRDRITRL
2260 2270 2280 2290 2300
GDVQYKMDED GFLRQRGGDV FEYNSAGLLI KAYNRASGWS VRYRYDGLGR
2310 2320 2330 2340 2350
RVSSKSSHSH HLQFFYADLT NPTKVTHLYN HSSSEITSLY YDLQGHLFAM
2360 2370 2380 2390 2400
ELSSGDEFYI ACDNIGTPLA VFSGTGLMIK QILYTAYGEI YMDTNPNFQI
2410 2420 2430 2440 2450
IIGYHGGLYD PLTKLVHMGR RDYDVLAGRW TSPDHELWKR LSSNSIVPFH
2460 2470 2480 2490 2500
LYMFKNNNPI SNSQDIKCFM TDVNSWLLTF GFQLHNVIPG YPKPDTDAME
2510 2520 2530 2540 2550
PSYELVHTQM KTQEWDNSKS ILGVQCEVQK QLKAFVTLER FDQLYGSTIT
2560 2570 2580 2590 2600
SCQQAPETKK FASSGSIFGK GVKFALKDGR VTTDIISVAN EDGRRIAAIL
2610 2620 2630 2640 2650
NNAHYLENLH FTIDGVDTHY FVKPGPSEGD LAILGLSGGR RTLENGVNVT
2660 2670 2680 2690 2700
VSQINTVLSG RTRRYTDIQL QYRALCLNTR YGTTVDEEKV RVLELARQRA
2710 2720 2730 2740 2750
VRQAWAREQQ RLREGEEGLR AWTDGEKQQV LNTGRVQGYD GFFVTSVEQY
2760 2770
PELSDSANNI HFMRQSEMGR R
Length:2,771
Mass (Da):308,425
Last modified:October 31, 2006 - v2
Checksum:i15EF31E25A171FD0
GO
Isoform 2 (identifier: Q3UHK6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     791-799: Missing.
     1269-1275: Missing.

Note: No experimental confirmation available.
Show »
Length:2,825
Mass (Da):313,428
Checksum:i820622CCE037744E
GO
Isoform 3 (identifier: Q3UHK6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     251-283: Missing.

Note: No experimental confirmation available.
Show »
Length:2,833
Mass (Da):314,673
Checksum:i1578D6B6F3E079B1
GO
Isoform 4 (identifier: Q3UHK6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM

Note: No experimental confirmation available.
Show »
Length:2,796
Mass (Da):311,192
Checksum:i70437010F777878E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti136 – 137TR → EK in BAE36695 (PubMed:16141072).Curated2
Sequence conflicti152 – 164LTLTD…ENTET → EKSGSASLGVAAN in BAE36695 (PubMed:16141072).CuratedAdd BLAST13
Sequence conflicti240L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti244N → K in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti247L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti261L → W in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti271L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti276H → R in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti286L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti422 – 429KPSSLFPE → RVAALSVL in BAE36695 (PubMed:16141072).Curated8
Sequence conflicti493F → L in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti780S → T in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti895S → P in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti1013C → R in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1039E → G in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti1077L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1133L → F in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti1457H → Q in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1743N → H in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1746A → G in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1831R → P in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1875L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1952N → D in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti2144T → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2160I → T in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2256K → R in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti2262F → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2330N → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2657V → M in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2657V → M in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti2657V → M in BAC65772 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0214041M → MEPDHSALSAARAQFVDVEE REPEAM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_021405164T → TGAPLHCSSASSTPIEQSPS PPPSPPANESQRRLLGNGVA QPTPDSDSEEEFVPNSFLVK SGSASLGVAAN in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_021406251 – 283Missing in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021407791 – 799Missing in isoform 2. 1 Publication9
Alternative sequenceiVSP_0214081269 – 1275Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059485 mRNA. Translation: AAC31807.1.
AB025413 mRNA. Translation: BAA77399.1.
AK147579 mRNA. Translation: BAE28005.1.
AK147329 mRNA. Translation: BAE27851.1.
AK162046 mRNA. Translation: BAE36695.1.
AK122490 mRNA. Translation: BAC65772.1.
CCDSiCCDS40024.1. [Q3UHK6-4]
CCDS80753.1. [Q3UHK6-3]
CCDS80754.1. [Q3UHK6-2]
PIRiT14271.
RefSeqiNP_001297689.1. NM_001310760.1. [Q3UHK6-3]
NP_001297691.1. NM_001310762.1. [Q3UHK6-2]
NP_035988.2. NM_011858.4. [Q3UHK6-4]
XP_017177717.1. XM_017322228.1. [Q3UHK6-4]
UniGeneiMm.254610.
Mm.391678.

Genome annotation databases

EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078. [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078. [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078. [Q3UHK6-4]
GeneIDi23966.
KEGGimmu:23966.
UCSCiuc009iio.1. mouse. [Q3UHK6-4]
uc009iip.1. mouse. [Q3UHK6-3]
uc009iiq.1. mouse. [Q3UHK6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059485 mRNA. Translation: AAC31807.1.
AB025413 mRNA. Translation: BAA77399.1.
AK147579 mRNA. Translation: BAE28005.1.
AK147329 mRNA. Translation: BAE27851.1.
AK162046 mRNA. Translation: BAE36695.1.
AK122490 mRNA. Translation: BAC65772.1.
CCDSiCCDS40024.1. [Q3UHK6-4]
CCDS80753.1. [Q3UHK6-3]
CCDS80754.1. [Q3UHK6-2]
PIRiT14271.
RefSeqiNP_001297689.1. NM_001310760.1. [Q3UHK6-3]
NP_001297691.1. NM_001310762.1. [Q3UHK6-2]
NP_035988.2. NM_011858.4. [Q3UHK6-4]
XP_017177717.1. XM_017322228.1. [Q3UHK6-4]
UniGeneiMm.254610.
Mm.391678.

3D structure databases

ProteinModelPortaliQ3UHK6.
SMRiQ3UHK6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ3UHK6. 1 interactor.
STRINGi10090.ENSMUSP00000102784.

PTM databases

iPTMnetiQ3UHK6.
PhosphoSitePlusiQ3UHK6.

Proteomic databases

MaxQBiQ3UHK6.
PaxDbiQ3UHK6.
PeptideAtlasiQ3UHK6.
PRIDEiQ3UHK6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078. [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078. [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078. [Q3UHK6-4]
GeneIDi23966.
KEGGimmu:23966.
UCSCiuc009iio.1. mouse. [Q3UHK6-4]
uc009iip.1. mouse. [Q3UHK6-3]
uc009iiq.1. mouse. [Q3UHK6-2]

Organism-specific databases

CTDi26011.
MGIiMGI:2447063. Tenm4.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410KDN2. Eukaryota.
ENOG410Z5H4. LUCA.
GeneTreeiENSGT00760000119131.
HOGENOMiHOG000231701.
HOVERGENiHBG080306.
InParanoidiQ3UHK6.
OMAiYEVSSPI.
OrthoDBiEOG091G02H3.
PhylomeDBiQ3UHK6.
TreeFamiTF316833.

Miscellaneous databases

PROiQ3UHK6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000048078.
CleanExiMM_ODZ4.
ExpressionAtlasiQ3UHK6. baseline and differential.
GenevisibleiQ3UHK6. MM.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR008969. CarboxyPept-like_regulatory.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR013111. EGF_extracell.
IPR022385. Rhs_assc_core.
IPR031325. RHS_repeat.
IPR027691. Ten-4.
IPR009471. Ten_N.
IPR028916. Tox-GHH_dom.
IPR006530. YD.
[Graphical view]
PANTHERiPTHR11219:SF9. PTHR11219:SF9. 2 hits.
PfamiPF07974. EGF_2. 1 hit.
PF05593. RHS_repeat. 1 hit.
PF06484. Ten_N. 2 hits.
PF15636. Tox-GHH. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 8 hits.
[Graphical view]
SUPFAMiSSF49464. SSF49464. 1 hit.
TIGRFAMsiTIGR03696. Rhs_assc_core. 1 hit.
TIGR01643. YD_repeat_2x. 1 hit.
PROSITEiPS00022. EGF_1. 8 hits.
PS01186. EGF_2. 7 hits.
PS50026. EGF_3. 5 hits.
PS51361. TENEURIN_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTEN4_MOUSE
AccessioniPrimary (citable) accession number: Q3UHK6
Secondary accession number(s): O70465
, Q3TSI0, Q3UH52, Q80TF5, Q9WTS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 2, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.