Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucoside xylosyltransferase 1

Gene

Gxylt1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.By similarity

Catalytic activityi

UDP-alpha-D-xylose + beta-D-glucosyl-R = UDP + alpha-D-xylose-(1->3)-beta-D-glucosyl-R.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

ReactomeiR-MMU-1971475. A tetrasaccharide linker sequence is required for GAG synthesis.

Protein family/group databases

CAZyiGT8. Glycosyltransferase Family 8.

Names & Taxonomyi

Protein namesi
Recommended name:
Glucoside xylosyltransferase 1 (EC:2.4.2.n2)
Alternative name(s):
Glycosyltransferase 8 domain-containing protein 3
Gene namesi
Name:Gxylt1
Synonyms:Glt8d3, Gm87
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2684933. Gxylt1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 66CytoplasmicSequence analysis
Transmembranei7 – 2923Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini30 – 404375LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 404404Glucoside xylosyltransferase 1PRO_0000288535Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi201 – 2011N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ3UHH8.
PaxDbiQ3UHH8.
PRIDEiQ3UHH8.

PTM databases

iPTMnetiQ3UHH8.
PhosphoSiteiQ3UHH8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036197.
CleanExiMM_GLT8D3.
ExpressionAtlasiQ3UHH8. baseline and differential.
GenevisibleiQ3UHH8. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047281.

Structurei

3D structure databases

ProteinModelPortaliQ3UHH8.
SMRiQ3UHH8. Positions 103-266.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 8 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3765. Eukaryota.
ENOG410XRNY. LUCA.
GeneTreeiENSGT00510000046589.
HOGENOMiHOG000264229.
HOVERGENiHBG059879.
InParanoidiQ3UHH8.
KOiK13676.
PhylomeDBiQ3UHH8.
TreeFamiTF323210.

Family and domain databases

Gene3Di3.90.550.10. 1 hit.
InterProiIPR002495. Glyco_trans_8.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PfamiPF01501. Glyco_transf_8. 1 hit.
[Graphical view]
SUPFAMiSSF53448. SSF53448. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UHH8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRYLRVVGL CLACGFCSLL YAFSQLAVSL EEGAAGGRRP QAAVVSWLAD
60 70 80 90 100
GGRGTGRGAG SAGPGRTGRY DMKTRPDEKM HLAVVACGER LEETVTMLKS
110 120 130 140 150
ALIFSIKPLH VHIFAEDQLH DSFKDRLASW SFLRRFDYSL YPITFPGDSA
160 170 180 190 200
ADWKKLFKPC ASQRLFLPLI LKEVDSLLYV DTDILFLRPV DDIWSLLKKF
210 220 230 240 250
NSTQIAAMAP EHEEPRIGWY NRFARHPYYG RTGVNSGVML MNMTRMRRKY
260 270 280 290 300
FKNDMTTARL QWGDILMPLL KKYKLNITWG DQDLLNIVFS HNPESLFVFP
310 320 330 340 350
CQWNYRPDHC IYGSNCREAE EEGVFILHGN RGVYHDDKQP AFRAVYEALR
360 370 380 390 400
NCSLEDDSVR SLLKPLELEL QKTVHTYCGK TYKIFIKQLT KSIRNRYDTP

PKER
Length:404
Mass (Da):46,491
Last modified:May 29, 2007 - v2
Checksum:iA0D1C1B9A2B6ADBC
GO
Isoform 2 (identifier: Q3UHH8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-404: SLEDDSVRSLLKPLELELQKTVHTYCGKTYKIFIKQLTKSIRNRYDTPPKER → WCLTASAVSLRGFRGWSGTD

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):42,480
Checksum:i9D54A960225F4CA4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei353 – 40452SLEDD…PPKER → WCLTASAVSLRGFRGWSGTD in isoform 2. 1 PublicationVSP_025710Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147387 mRNA. Translation: BAE27879.1.
AC127360 Genomic DNA. No translation available.
CH466550 Genomic DNA. Translation: EDL04286.1.
BC141302 mRNA. Translation: AAI41303.1.
BC171972 mRNA. Translation: AAI71972.1.
CCDSiCCDS27764.1. [Q3UHH8-2]
RefSeqiNP_001028447.1. NM_001033275.4. [Q3UHH8-2]
XP_006520912.1. XM_006520849.1. [Q3UHH8-1]
UniGeneiMm.22819.

Genome annotation databases

EnsembliENSMUST00000049484; ENSMUSP00000047281; ENSMUSG00000036197. [Q3UHH8-2]
GeneIDi223827.
KEGGimmu:223827.
UCSCiuc007xiq.1. mouse. [Q3UHH8-2]
uc011zyf.1. mouse. [Q3UHH8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147387 mRNA. Translation: BAE27879.1.
AC127360 Genomic DNA. No translation available.
CH466550 Genomic DNA. Translation: EDL04286.1.
BC141302 mRNA. Translation: AAI41303.1.
BC171972 mRNA. Translation: AAI71972.1.
CCDSiCCDS27764.1. [Q3UHH8-2]
RefSeqiNP_001028447.1. NM_001033275.4. [Q3UHH8-2]
XP_006520912.1. XM_006520849.1. [Q3UHH8-1]
UniGeneiMm.22819.

3D structure databases

ProteinModelPortaliQ3UHH8.
SMRiQ3UHH8. Positions 103-266.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047281.

Protein family/group databases

CAZyiGT8. Glycosyltransferase Family 8.

PTM databases

iPTMnetiQ3UHH8.
PhosphoSiteiQ3UHH8.

Proteomic databases

MaxQBiQ3UHH8.
PaxDbiQ3UHH8.
PRIDEiQ3UHH8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049484; ENSMUSP00000047281; ENSMUSG00000036197. [Q3UHH8-2]
GeneIDi223827.
KEGGimmu:223827.
UCSCiuc007xiq.1. mouse. [Q3UHH8-2]
uc011zyf.1. mouse. [Q3UHH8-1]

Organism-specific databases

CTDi283464.
MGIiMGI:2684933. Gxylt1.

Phylogenomic databases

eggNOGiKOG3765. Eukaryota.
ENOG410XRNY. LUCA.
GeneTreeiENSGT00510000046589.
HOGENOMiHOG000264229.
HOVERGENiHBG059879.
InParanoidiQ3UHH8.
KOiK13676.
PhylomeDBiQ3UHH8.
TreeFamiTF323210.

Enzyme and pathway databases

ReactomeiR-MMU-1971475. A tetrasaccharide linker sequence is required for GAG synthesis.

Miscellaneous databases

PROiQ3UHH8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036197.
CleanExiMM_GLT8D3.
ExpressionAtlasiQ3UHH8. baseline and differential.
GenevisibleiQ3UHH8. MM.

Family and domain databases

Gene3Di3.90.550.10. 1 hit.
InterProiIPR002495. Glyco_trans_8.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PfamiPF01501. Glyco_transf_8. 1 hit.
[Graphical view]
SUPFAMiSSF53448. SSF53448. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGXLT1_MOUSE
AccessioniPrimary (citable) accession number: Q3UHH8
Secondary accession number(s): B7ZWC3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: September 7, 2016
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.