Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3UH06

- RREB1_MOUSE

UniProt

Q3UH06 - RREB1_MOUSE

Protein

Ras-responsive element-binding protein 1

Gene

Rreb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 84 (01 Oct 2014)
      Sequence version 2 (10 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1 By similarity. Binds specifically to the allelic variant of the CDKN2A promoter present in Balb/c mice, which leads to a down-regulation of CDKN2A expression in this strain, and, as a consequence, to an elevated susceptibility to pristane-induced tumors.By similarity1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri66 – 8823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri97 – 11923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri125 – 14723C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri206 – 22823C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri233 – 25624C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri314 – 33623C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri641 – 66323C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri669 – 69123C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri697 – 72024C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri751 – 78232C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri788 – 81326C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1251 – 127323C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1400 – 142223C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1520 – 154223C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1548 – 157023C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: MGI

    GO - Biological processi

    1. negative regulation of transcription, DNA-templated Source: MGI
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-responsive element-binding protein 1
    Short name:
    RREB-1
    Alternative name(s):
    RAS-responsive zinc finger transcription factor RREB
    Gene namesi
    Name:Rreb1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:2443664. Rreb1.

    Subcellular locationi

    Nucleus speckle By similarity

    GO - Cellular componenti

    1. nuclear speck Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 17001700Ras-responsive element-binding protein 1PRO_0000295155Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei36 – 361PhosphoserineBy similarity
    Modified residuei42 – 421PhosphoserineBy similarity
    Modified residuei161 – 1611PhosphoserineBy similarity
    Modified residuei229 – 2291PhosphoserineBy similarity
    Modified residuei1125 – 11251PhosphoserineBy similarity
    Modified residuei1137 – 11371Phosphoserine1 Publication
    Modified residuei1138 – 11381Phosphoserine1 Publication
    Modified residuei1172 – 11721PhosphoserineBy similarity
    Modified residuei1179 – 11791Phosphoserine1 Publication
    Modified residuei1180 – 11801Phosphoserine1 Publication
    Modified residuei1230 – 12301PhosphoserineBy similarity
    Modified residuei1667 – 16671PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ3UH06.
    PRIDEiQ3UH06.

    PTM databases

    PhosphoSiteiQ3UH06.

    Expressioni

    Tissue specificityi

    Expressed in splenic B-cells.1 Publication

    Gene expression databases

    ArrayExpressiQ3UH06.
    BgeeiQ3UH06.
    CleanExiMM_RREB1.
    GenevestigatoriQ3UH06.

    Interactioni

    Subunit structurei

    Interacts with NEUROD1 and AR.By similarity

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000115599.

    Structurei

    3D structure databases

    ProteinModelPortaliQ3UH06.
    SMRiQ3UH06. Positions 66-257, 303-353, 606-806, 1522-1620.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi479 – 54264Pro-richAdd
    BLAST
    Compositional biasi921 – 9255Poly-Ser
    Compositional biasi1320 – 13256Poly-Ala
    Compositional biasi1328 – 135932Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 15 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri66 – 8823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri97 – 11923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri125 – 14723C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri206 – 22823C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri233 – 25624C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri314 – 33623C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri641 – 66323C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri669 – 69123C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri697 – 72024C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri751 – 78232C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri788 – 81326C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1251 – 127323C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1400 – 142223C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1520 – 154223C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1548 – 157023C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG256116.
    GeneTreeiENSGT00720000108795.
    HOGENOMiHOG000154195.
    HOVERGENiHBG108418.
    OMAiASIEKML.
    OrthoDBiEOG7S21X0.
    PhylomeDBiQ3UH06.
    TreeFamiTF332503.

    Family and domain databases

    Gene3Di3.30.160.60. 8 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 15 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
    PS50157. ZINC_FINGER_C2H2_2. 14 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q3UH06-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSNSPIGLE GSDLSSINTM MSAVMSVASV TENGGSPQGI KSPMKPPGPN     50
    RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHACS 100
    ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD 150
    TNSTTAAAPP SPLKRRRLSS KRKLSHDAES EDPGPAKKMV EDGQSGDLDK 200
    MSDEIFHCPV CFKEFVCKYE LETHMETHSD NPLRCDICCV TFRTHRGLLR 250
    HNALVHKQLP RDAMGRPFIQ NNPSIPAGFH DLGFTDFSCR KFPRISQAWC 300
    ETNLRRCISE QHRFVCDTCD KAFPMLSSLI LHRQSHIPAD QGREKLQTKT 350
    LAAESLEQKA FLALLGLQHT KDVKPAPAEE LLPDDNQAIQ LQTLKYQLPQ 400
    EPGCPTVLSV SPLDAASLGG SLTVLPATKE NMKHLSLQPF QKGFIIQPDS 450
    SIVVKPISGE SAIELADIQQ ILKMAASAPP QISLPPLSKA PATPLQAIFK 500
    HMPPLKPKPL VTPRTVVAAS TPPPLINAQQ ASPGCISPSL PPQSLKFLKG 550
    SVEAVSNVHL LQSKSGIQPS TTTQLFLQQA GVELPGQPEM KTQLEQESII 600
    EALLPLNMEA KIKQEITEGD LKAIMTGPSG KKTPAMRKVL YPCRFCNQVF 650
    AFSGVLRAHV RSHLGISPYQ CNICDYIAAD KAALIRHIRT HSGERPYICK 700
    ICHYPFTVKA NCERHLRKKH LKATRKDIEK NIEYVSSPTA ELVDAFCAPE 750
    TVCRLCGEDL KHYRALRIHM RTHCSRGLGG CHKGRKPFEC KECNAPFVAK 800
    RNCIHHILKQ HLHVPEKDIE SYVLATNSGL GPADTPTDAA SRGEEGSCVT 850
    FAECKPLATF LEPQNGFLHS SPTQPLPSHI SVKLEPASSF AMDFNEPLDF 900
    SQKGLALVQV KQENVSSLLT SSSSSALYDC SMEPIDLSIP KSVKKGDKDT 950
    VVPSDAKKPE PEAGQAEPLS PRPPPCPTLS VTVEPKGSLE TPTGTVVAVT 1000
    TAAKLEPHTQ PLQGSVQLAV PIYSPALVSN TPLLGNSAAL LNNPALLRPL 1050
    RPKPPLLLPK PSMTEELPPL ASIAQIISSV SSAPTLLKTK VADPGPSITS 1100
    SNTVATDSPG SSIPKAAATP TDTTSSKESS EPPPAASSPE EALPTEQGPA 1150
    ATSSSRKRGR KRGLRNRPLP NSSAVDLDSS GEFASIEKML ATTDTNKFSP 1200
    FLQTAEDDTQ EEVAGAPADQ HGPADEEQGS PAEDRLLRAK RNSYANCLQK 1250
    INCPHCPRVF PWASSLQRHM LTHTDSQSDT DTLTTPGEVL DLTAQAKEQP 1300
    PAEGASEISP ASQDLAIKEA KAAAAPSEEE EEKETEENPE PEEECRVEES 1350
    TGAADAPEED TASNQSLDLD FATKLMDFKL AESEAGSVDS QGPAQQEPKH 1400
    ACDTCGKNFK FLGTLSRHKK AHSCQEPKEE EAAAPSLENE GVGRAVEGPS 1450
    PSPEPEEKPA ESLAIDPTPG TREASVAKQN EETEGPTDGE GTAEKRGDGD 1500
    KRPKTDSPKS MASKADKRKK VCSVCNKRFW SLQDLTRHMR SHTGERPYKC 1550
    QTCERTFTLK HSLVRHQRIH QKARHSKHHG KDSDKDERAE EDSEDESTHS 1600
    ATNPASENEA ESAPSTSNHV AVTRSRKESL STSGKECSPE ERAAAEQAAE 1650
    PSAPKEQASP GETDPQSPAA IVQDLLELCG KRPAPILAAT DGASQLLGME 1700
    Length:1,700
    Mass (Da):184,154
    Last modified:July 10, 2007 - v2
    Checksum:iDAB9246A566B1BC9
    GO
    Isoform 2 (identifier: Q3UH06-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-82: Missing.

    Show »
    Length:1,618
    Mass (Da):175,402
    Checksum:i52678CF395D69693
    GO
    Isoform 3 (identifier: Q3UH06-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1274-1274: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPPKESDVGSHDST

    Show »
    Length:1,754
    Mass (Da):190,167
    Checksum:iEE5F35416BEC03BC
    GO
    Isoform 4 (identifier: Q3UH06-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1275-1291: DSQSDTDTLTTPGEVLD → GKKALTAHQAVSLERKE
         1292-1700: Missing.

    Show »
    Length:1,291
    Mass (Da):140,184
    Checksum:i8AAF680E466B62B7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti834 – 8341D → G in BAE28051. (PubMed:16141072)Curated
    Sequence conflicti1113 – 11131I → T in AAH80680. 1 PublicationCurated
    Sequence conflicti1178 – 11781D → G in BAE28051. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8282Missing in isoform 2. 1 PublicationVSP_026765Add
    BLAST
    Alternative sequencei1274 – 12741T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPPKESDVGSHDST in isoform 3. 1 PublicationVSP_026766
    Alternative sequencei1275 – 129117DSQSD…GEVLD → GKKALTAHQAVSLERKE in isoform 4. 2 PublicationsVSP_026767Add
    BLAST
    Alternative sequencei1292 – 1700409Missing in isoform 4. 2 PublicationsVSP_026768Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK147653 mRNA. Translation: BAE28051.1.
    AK154980 mRNA. Translation: BAE32969.1.
    AK171375 mRNA. Translation: BAE42417.1.
    CT010477 Genomic DNA. Translation: CAX15920.1.
    CT010477 Genomic DNA. Translation: CAX15921.1.
    BC080680 mRNA. Translation: AAH80680.1.
    AY946044 mRNA. Translation: AAX83010.1.
    CCDSiCCDS36634.1. [Q3UH06-4]
    CCDS49238.1. [Q3UH06-3]
    RefSeqiNP_001034277.1. NM_001039188.1. [Q3UH06-4]
    NP_001171339.1. NM_001177868.1. [Q3UH06-4]
    NP_001171340.1. NM_001177869.1. [Q3UH06-3]
    NP_081106.1. NM_026830.2. [Q3UH06-4]
    XP_006516812.1. XM_006516749.1. [Q3UH06-3]
    XP_006516813.1. XM_006516750.1. [Q3UH06-3]
    XP_006516814.1. XM_006516751.1. [Q3UH06-3]
    XP_006516815.1. XM_006516752.1. [Q3UH06-3]
    XP_006516816.1. XM_006516753.1. [Q3UH06-3]
    XP_006516817.1. XM_006516754.1. [Q3UH06-3]
    XP_006516818.1. XM_006516755.1. [Q3UH06-3]
    XP_006516819.1. XM_006516756.1. [Q3UH06-3]
    XP_006516820.1. XM_006516757.1. [Q3UH06-3]
    XP_006516822.1. XM_006516759.1. [Q3UH06-1]
    UniGeneiMm.491109.

    Genome annotation databases

    EnsembliENSMUST00000037232; ENSMUSP00000049265; ENSMUSG00000039087. [Q3UH06-3]
    ENSMUST00000110237; ENSMUSP00000105866; ENSMUSG00000039087. [Q3UH06-4]
    ENSMUST00000110238; ENSMUSP00000105867; ENSMUSG00000039087. [Q3UH06-4]
    ENSMUST00000128570; ENSMUSP00000115599; ENSMUSG00000039087. [Q3UH06-3]
    ENSMUST00000149745; ENSMUSP00000121211; ENSMUSG00000039087. [Q3UH06-4]
    GeneIDi68750.
    KEGGimmu:68750.
    UCSCiuc007qcw.2. mouse. [Q3UH06-4]
    uc007qda.2. mouse. [Q3UH06-1]
    uc007qdb.2. mouse. [Q3UH06-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK147653 mRNA. Translation: BAE28051.1 .
    AK154980 mRNA. Translation: BAE32969.1 .
    AK171375 mRNA. Translation: BAE42417.1 .
    CT010477 Genomic DNA. Translation: CAX15920.1 .
    CT010477 Genomic DNA. Translation: CAX15921.1 .
    BC080680 mRNA. Translation: AAH80680.1 .
    AY946044 mRNA. Translation: AAX83010.1 .
    CCDSi CCDS36634.1. [Q3UH06-4 ]
    CCDS49238.1. [Q3UH06-3 ]
    RefSeqi NP_001034277.1. NM_001039188.1. [Q3UH06-4 ]
    NP_001171339.1. NM_001177868.1. [Q3UH06-4 ]
    NP_001171340.1. NM_001177869.1. [Q3UH06-3 ]
    NP_081106.1. NM_026830.2. [Q3UH06-4 ]
    XP_006516812.1. XM_006516749.1. [Q3UH06-3 ]
    XP_006516813.1. XM_006516750.1. [Q3UH06-3 ]
    XP_006516814.1. XM_006516751.1. [Q3UH06-3 ]
    XP_006516815.1. XM_006516752.1. [Q3UH06-3 ]
    XP_006516816.1. XM_006516753.1. [Q3UH06-3 ]
    XP_006516817.1. XM_006516754.1. [Q3UH06-3 ]
    XP_006516818.1. XM_006516755.1. [Q3UH06-3 ]
    XP_006516819.1. XM_006516756.1. [Q3UH06-3 ]
    XP_006516820.1. XM_006516757.1. [Q3UH06-3 ]
    XP_006516822.1. XM_006516759.1. [Q3UH06-1 ]
    UniGenei Mm.491109.

    3D structure databases

    ProteinModelPortali Q3UH06.
    SMRi Q3UH06. Positions 66-257, 303-353, 606-806, 1522-1620.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000115599.

    PTM databases

    PhosphoSitei Q3UH06.

    Proteomic databases

    PaxDbi Q3UH06.
    PRIDEi Q3UH06.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000037232 ; ENSMUSP00000049265 ; ENSMUSG00000039087 . [Q3UH06-3 ]
    ENSMUST00000110237 ; ENSMUSP00000105866 ; ENSMUSG00000039087 . [Q3UH06-4 ]
    ENSMUST00000110238 ; ENSMUSP00000105867 ; ENSMUSG00000039087 . [Q3UH06-4 ]
    ENSMUST00000128570 ; ENSMUSP00000115599 ; ENSMUSG00000039087 . [Q3UH06-3 ]
    ENSMUST00000149745 ; ENSMUSP00000121211 ; ENSMUSG00000039087 . [Q3UH06-4 ]
    GeneIDi 68750.
    KEGGi mmu:68750.
    UCSCi uc007qcw.2. mouse. [Q3UH06-4 ]
    uc007qda.2. mouse. [Q3UH06-1 ]
    uc007qdb.2. mouse. [Q3UH06-3 ]

    Organism-specific databases

    CTDi 6239.
    MGIi MGI:2443664. Rreb1.

    Phylogenomic databases

    eggNOGi NOG256116.
    GeneTreei ENSGT00720000108795.
    HOGENOMi HOG000154195.
    HOVERGENi HBG108418.
    OMAi ASIEKML.
    OrthoDBi EOG7S21X0.
    PhylomeDBi Q3UH06.
    TreeFami TF332503.

    Miscellaneous databases

    ChiTaRSi RREB1. mouse.
    NextBioi 327842.
    PROi Q3UH06.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q3UH06.
    Bgeei Q3UH06.
    CleanExi MM_RREB1.
    Genevestigatori Q3UH06.

    Family and domain databases

    Gene3Di 3.30.160.60. 8 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 15 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 14 hits.
    PS50157. ZINC_FINGER_C2H2_2. 14 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Strain: C57BL/6, C57BL/6J and NOD.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Embryo.
    4. "Role of mouse RREB gene in cancer susceptibility/resistance."
      Zhang S., Bliskovsky V., Mock B.
      Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 21-1700 (ISOFORM 3).
      Strain: BALB/c.
    5. "p16 INK4a gene promoter variation and differential binding of a repressor, the ras-responsive zinc-finger transcription factor, RREB."
      Zhang S., Qian X., Redman C., Bliskovski V., Ramsay E.S., Lowy D.R., Mock B.A.
      Oncogene 22:2285-2295(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1137; SER-1138; SER-1179 AND SER-1180, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiRREB1_MOUSE
    AccessioniPrimary (citable) accession number: Q3UH06
    Secondary accession number(s): B8JJE2
    , B8JJE3, Q3TB97, Q4ZE88, Q66JZ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: July 10, 2007
    Last modified: October 1, 2014
    This is version 84 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3