Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q3UH06 (RREB1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras-responsive element-binding protein 1

Short name=RREB-1
Alternative name(s):
RAS-responsive zinc finger transcription factor RREB
Gene names
Name:Rreb1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1700 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1 By similarity. Binds specifically to the allelic variant of the CDKN2A promoter present in Balb/c mice, which leads to a down-regulation of CDKN2A expression in this strain, and, as a consequence, to an elevated susceptibility to pristane-induced tumors. Ref.5

Subunit structure

Interacts with NEUROD1 and AR By similarity.

Subcellular location

Nucleus speckle By similarity.

Tissue specificity

Expressed in splenic B-cells. Ref.5

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 15 C2H2-type zinc fingers.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q3UH06-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q3UH06-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
Isoform 3 (identifier: Q3UH06-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1274-1274: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPPKESDVGSHDST
Isoform 4 (identifier: Q3UH06-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1275-1291: DSQSDTDTLTTPGEVLD → GKKALTAHQAVSLERKE
     1292-1700: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 17001700Ras-responsive element-binding protein 1
PRO_0000295155

Regions

Zinc finger66 – 8823C2H2-type 1
Zinc finger97 – 11923C2H2-type 2
Zinc finger125 – 14723C2H2-type 3
Zinc finger206 – 22823C2H2-type 4
Zinc finger233 – 25624C2H2-type 5
Zinc finger314 – 33623C2H2-type 6
Zinc finger641 – 66323C2H2-type 7
Zinc finger669 – 69123C2H2-type 8
Zinc finger697 – 72024C2H2-type 9
Zinc finger751 – 78232C2H2-type 10
Zinc finger788 – 81326C2H2-type 11
Zinc finger1251 – 127323C2H2-type 12
Zinc finger1400 – 142223C2H2-type 13
Zinc finger1520 – 154223C2H2-type 14
Zinc finger1548 – 157023C2H2-type 15
Compositional bias479 – 54264Pro-rich
Compositional bias921 – 9255Poly-Ser
Compositional bias1320 – 13256Poly-Ala
Compositional bias1328 – 135932Glu-rich

Amino acid modifications

Modified residue361Phosphoserine By similarity
Modified residue421Phosphoserine By similarity
Modified residue1611Phosphoserine By similarity
Modified residue2291Phosphoserine By similarity
Modified residue11251Phosphoserine By similarity
Modified residue11371Phosphoserine Ref.6
Modified residue11381Phosphoserine Ref.6
Modified residue11721Phosphoserine By similarity
Modified residue11791Phosphoserine Ref.6
Modified residue11801Phosphoserine Ref.6
Modified residue12301Phosphoserine By similarity
Modified residue16671Phosphoserine By similarity

Natural variations

Alternative sequence1 – 8282Missing in isoform 2.
VSP_026765
Alternative sequence12741T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPPKESDVGSHDST in isoform 3.
VSP_026766
Alternative sequence1275 – 129117DSQSD…GEVLD → GKKALTAHQAVSLERKE in isoform 4.
VSP_026767
Alternative sequence1292 – 1700409Missing in isoform 4.
VSP_026768

Experimental info

Sequence conflict8341D → G in BAE28051. Ref.1
Sequence conflict11131I → T in AAH80680. Ref.4
Sequence conflict11781D → G in BAE28051. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 10, 2007. Version 2.
Checksum: DAB9246A566B1BC9

FASTA1,700184,154
        10         20         30         40         50         60 
MTSNSPIGLE GSDLSSINTM MSAVMSVASV TENGGSPQGI KSPMKPPGPN RIGRRNQETK 

        70         80         90        100        110        120 
EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHACS ICGKSLSSAS SLDRHMLVHS 

       130        140        150        160        170        180 
GERPYKCTVC GQSFTTNGNM HRHMKIHEKD TNSTTAAAPP SPLKRRRLSS KRKLSHDAES 

       190        200        210        220        230        240 
EDPGPAKKMV EDGQSGDLDK MSDEIFHCPV CFKEFVCKYE LETHMETHSD NPLRCDICCV 

       250        260        270        280        290        300 
TFRTHRGLLR HNALVHKQLP RDAMGRPFIQ NNPSIPAGFH DLGFTDFSCR KFPRISQAWC 

       310        320        330        340        350        360 
ETNLRRCISE QHRFVCDTCD KAFPMLSSLI LHRQSHIPAD QGREKLQTKT LAAESLEQKA 

       370        380        390        400        410        420 
FLALLGLQHT KDVKPAPAEE LLPDDNQAIQ LQTLKYQLPQ EPGCPTVLSV SPLDAASLGG 

       430        440        450        460        470        480 
SLTVLPATKE NMKHLSLQPF QKGFIIQPDS SIVVKPISGE SAIELADIQQ ILKMAASAPP 

       490        500        510        520        530        540 
QISLPPLSKA PATPLQAIFK HMPPLKPKPL VTPRTVVAAS TPPPLINAQQ ASPGCISPSL 

       550        560        570        580        590        600 
PPQSLKFLKG SVEAVSNVHL LQSKSGIQPS TTTQLFLQQA GVELPGQPEM KTQLEQESII 

       610        620        630        640        650        660 
EALLPLNMEA KIKQEITEGD LKAIMTGPSG KKTPAMRKVL YPCRFCNQVF AFSGVLRAHV 

       670        680        690        700        710        720 
RSHLGISPYQ CNICDYIAAD KAALIRHIRT HSGERPYICK ICHYPFTVKA NCERHLRKKH 

       730        740        750        760        770        780 
LKATRKDIEK NIEYVSSPTA ELVDAFCAPE TVCRLCGEDL KHYRALRIHM RTHCSRGLGG 

       790        800        810        820        830        840 
CHKGRKPFEC KECNAPFVAK RNCIHHILKQ HLHVPEKDIE SYVLATNSGL GPADTPTDAA 

       850        860        870        880        890        900 
SRGEEGSCVT FAECKPLATF LEPQNGFLHS SPTQPLPSHI SVKLEPASSF AMDFNEPLDF 

       910        920        930        940        950        960 
SQKGLALVQV KQENVSSLLT SSSSSALYDC SMEPIDLSIP KSVKKGDKDT VVPSDAKKPE 

       970        980        990       1000       1010       1020 
PEAGQAEPLS PRPPPCPTLS VTVEPKGSLE TPTGTVVAVT TAAKLEPHTQ PLQGSVQLAV 

      1030       1040       1050       1060       1070       1080 
PIYSPALVSN TPLLGNSAAL LNNPALLRPL RPKPPLLLPK PSMTEELPPL ASIAQIISSV 

      1090       1100       1110       1120       1130       1140 
SSAPTLLKTK VADPGPSITS SNTVATDSPG SSIPKAAATP TDTTSSKESS EPPPAASSPE 

      1150       1160       1170       1180       1190       1200 
EALPTEQGPA ATSSSRKRGR KRGLRNRPLP NSSAVDLDSS GEFASIEKML ATTDTNKFSP 

      1210       1220       1230       1240       1250       1260 
FLQTAEDDTQ EEVAGAPADQ HGPADEEQGS PAEDRLLRAK RNSYANCLQK INCPHCPRVF 

      1270       1280       1290       1300       1310       1320 
PWASSLQRHM LTHTDSQSDT DTLTTPGEVL DLTAQAKEQP PAEGASEISP ASQDLAIKEA 

      1330       1340       1350       1360       1370       1380 
KAAAAPSEEE EEKETEENPE PEEECRVEES TGAADAPEED TASNQSLDLD FATKLMDFKL 

      1390       1400       1410       1420       1430       1440 
AESEAGSVDS QGPAQQEPKH ACDTCGKNFK FLGTLSRHKK AHSCQEPKEE EAAAPSLENE 

      1450       1460       1470       1480       1490       1500 
GVGRAVEGPS PSPEPEEKPA ESLAIDPTPG TREASVAKQN EETEGPTDGE GTAEKRGDGD 

      1510       1520       1530       1540       1550       1560 
KRPKTDSPKS MASKADKRKK VCSVCNKRFW SLQDLTRHMR SHTGERPYKC QTCERTFTLK 

      1570       1580       1590       1600       1610       1620 
HSLVRHQRIH QKARHSKHHG KDSDKDERAE EDSEDESTHS ATNPASENEA ESAPSTSNHV 

      1630       1640       1650       1660       1670       1680 
AVTRSRKESL STSGKECSPE ERAAAEQAAE PSAPKEQASP GETDPQSPAA IVQDLLELCG 

      1690       1700 
KRPAPILAAT DGASQLLGME 

« Hide

Isoform 2 [UniParc].

Checksum: 52678CF395D69693
Show »

FASTA1,618175,402
Isoform 3 [UniParc].

Checksum: EE5F35416BEC03BC
Show »

FASTA1,754190,167
Isoform 4 [UniParc].

Checksum: 8AAF680E466B62B7
Show »

FASTA1,291140,184

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Strain: C57BL/6, C57BL/6J and NOD.
Tissue: Brain.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Embryo.
[4]"Role of mouse RREB gene in cancer susceptibility/resistance."
Zhang S., Bliskovsky V., Mock B.
Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 21-1700 (ISOFORM 3).
Strain: BALB/c.
[5]"p16 INK4a gene promoter variation and differential binding of a repressor, the ras-responsive zinc-finger transcription factor, RREB."
Zhang S., Qian X., Redman C., Bliskovski V., Ramsay E.S., Lowy D.R., Mock B.A.
Oncogene 22:2285-2295(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[6]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1137; SER-1138; SER-1179 AND SER-1180, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK147653 mRNA. Translation: BAE28051.1.
AK154980 mRNA. Translation: BAE32969.1.
AK171375 mRNA. Translation: BAE42417.1.
CT010477 Genomic DNA. Translation: CAX15920.1.
CT010477 Genomic DNA. Translation: CAX15921.1.
BC080680 mRNA. Translation: AAH80680.1.
AY946044 mRNA. Translation: AAX83010.1.
RefSeqNP_001034277.1. NM_001039188.1.
NP_001171339.1. NM_001177868.1.
NP_001171340.1. NM_001177869.1.
NP_081106.1. NM_026830.2.
XP_006516812.1. XM_006516749.1.
XP_006516813.1. XM_006516750.1.
XP_006516814.1. XM_006516751.1.
XP_006516815.1. XM_006516752.1.
XP_006516816.1. XM_006516753.1.
XP_006516817.1. XM_006516754.1.
XP_006516818.1. XM_006516755.1.
XP_006516819.1. XM_006516756.1.
XP_006516820.1. XM_006516757.1.
XP_006516822.1. XM_006516759.1.
UniGeneMm.491109.

3D structure databases

ProteinModelPortalQ3UH06.
SMRQ3UH06. Positions 64-259, 310-370, 567-844, 1522-1620.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10090.ENSMUSP00000115599.

PTM databases

PhosphoSiteQ3UH06.

Proteomic databases

PaxDbQ3UH06.
PRIDEQ3UH06.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000037232; ENSMUSP00000049265; ENSMUSG00000039087. [Q3UH06-3]
ENSMUST00000110237; ENSMUSP00000105866; ENSMUSG00000039087. [Q3UH06-4]
ENSMUST00000110238; ENSMUSP00000105867; ENSMUSG00000039087. [Q3UH06-4]
ENSMUST00000128570; ENSMUSP00000115599; ENSMUSG00000039087. [Q3UH06-3]
ENSMUST00000149745; ENSMUSP00000121211; ENSMUSG00000039087. [Q3UH06-4]
GeneID68750.
KEGGmmu:68750.
UCSCuc007qcw.2. mouse. [Q3UH06-4]
uc007qda.2. mouse. [Q3UH06-1]
uc007qdb.2. mouse. [Q3UH06-3]

Organism-specific databases

CTD6239.
MGIMGI:2443664. Rreb1.

Phylogenomic databases

eggNOGNOG256116.
GeneTreeENSGT00720000108795.
HOGENOMHOG000154195.
HOVERGENHBG108418.
OMAASIEKML.
OrthoDBEOG7S21X0.
PhylomeDBQ3UH06.
TreeFamTF332503.

Gene expression databases

ArrayExpressQ3UH06.
BgeeQ3UH06.
CleanExMM_RREB1.
GenevestigatorQ3UH06.

Family and domain databases

Gene3D3.30.160.60. 8 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRREB1. mouse.
NextBio327842.
PROQ3UH06.
SOURCESearch...

Entry information

Entry nameRREB1_MOUSE
AccessionPrimary (citable) accession number: Q3UH06
Secondary accession number(s): B8JJE2 expand/collapse secondary AC list , B8JJE3, Q3TB97, Q4ZE88, Q66JZ8
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: April 16, 2014
This is version 80 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot