SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3UH06

- RREB1_MOUSE

UniProt

Q3UH06 - RREB1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ras-responsive element-binding protein 1
Gene
Rreb1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1 By similarity. Binds specifically to the allelic variant of the CDKN2A promoter present in Balb/c mice, which leads to a down-regulation of CDKN2A expression in this strain, and, as a consequence, to an elevated susceptibility to pristane-induced tumors.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri66 – 8823C2H2-type 1
Add
BLAST
Zinc fingeri97 – 11923C2H2-type 2
Add
BLAST
Zinc fingeri125 – 14723C2H2-type 3
Add
BLAST
Zinc fingeri206 – 22823C2H2-type 4
Add
BLAST
Zinc fingeri233 – 25624C2H2-type 5
Add
BLAST
Zinc fingeri314 – 33623C2H2-type 6
Add
BLAST
Zinc fingeri641 – 66323C2H2-type 7
Add
BLAST
Zinc fingeri669 – 69123C2H2-type 8
Add
BLAST
Zinc fingeri697 – 72024C2H2-type 9
Add
BLAST
Zinc fingeri751 – 78232C2H2-type 10
Add
BLAST
Zinc fingeri788 – 81326C2H2-type 11
Add
BLAST
Zinc fingeri1251 – 127323C2H2-type 12
Add
BLAST
Zinc fingeri1400 – 142223C2H2-type 13
Add
BLAST
Zinc fingeri1520 – 154223C2H2-type 14
Add
BLAST
Zinc fingeri1548 – 157023C2H2-type 15
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: MGI

GO - Biological processi

  1. negative regulation of transcription, DNA-templated Source: MGI
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-responsive element-binding protein 1
Short name:
RREB-1
Alternative name(s):
RAS-responsive zinc finger transcription factor RREB
Gene namesi
Name:Rreb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:2443664. Rreb1.

Subcellular locationi

Nucleus speckle By similarity

GO - Cellular componenti

  1. nuclear speck Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17001700Ras-responsive element-binding protein 1
PRO_0000295155Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei36 – 361Phosphoserine By similarity
Modified residuei42 – 421Phosphoserine By similarity
Modified residuei161 – 1611Phosphoserine By similarity
Modified residuei229 – 2291Phosphoserine By similarity
Modified residuei1125 – 11251Phosphoserine By similarity
Modified residuei1137 – 11371Phosphoserine1 Publication
Modified residuei1138 – 11381Phosphoserine1 Publication
Modified residuei1172 – 11721Phosphoserine By similarity
Modified residuei1179 – 11791Phosphoserine1 Publication
Modified residuei1180 – 11801Phosphoserine1 Publication
Modified residuei1230 – 12301Phosphoserine By similarity
Modified residuei1667 – 16671Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ3UH06.
PRIDEiQ3UH06.

PTM databases

PhosphoSiteiQ3UH06.

Expressioni

Tissue specificityi

Expressed in splenic B-cells.1 Publication

Gene expression databases

ArrayExpressiQ3UH06.
BgeeiQ3UH06.
CleanExiMM_RREB1.
GenevestigatoriQ3UH06.

Interactioni

Subunit structurei

Interacts with NEUROD1 and AR By similarity.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000115599.

Structurei

3D structure databases

ProteinModelPortaliQ3UH06.
SMRiQ3UH06. Positions 66-257, 303-353, 606-806, 1522-1620.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi479 – 54264Pro-rich
Add
BLAST
Compositional biasi921 – 9255Poly-Ser
Compositional biasi1320 – 13256Poly-Ala
Compositional biasi1328 – 135932Glu-rich
Add
BLAST

Sequence similaritiesi

Contains 15 C2H2-type zinc fingers.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG256116.
GeneTreeiENSGT00720000108795.
HOGENOMiHOG000154195.
HOVERGENiHBG108418.
OMAiASIEKML.
OrthoDBiEOG7S21X0.
PhylomeDBiQ3UH06.
TreeFamiTF332503.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3UH06-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTSNSPIGLE GSDLSSINTM MSAVMSVASV TENGGSPQGI KSPMKPPGPN     50
RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHACS 100
ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD 150
TNSTTAAAPP SPLKRRRLSS KRKLSHDAES EDPGPAKKMV EDGQSGDLDK 200
MSDEIFHCPV CFKEFVCKYE LETHMETHSD NPLRCDICCV TFRTHRGLLR 250
HNALVHKQLP RDAMGRPFIQ NNPSIPAGFH DLGFTDFSCR KFPRISQAWC 300
ETNLRRCISE QHRFVCDTCD KAFPMLSSLI LHRQSHIPAD QGREKLQTKT 350
LAAESLEQKA FLALLGLQHT KDVKPAPAEE LLPDDNQAIQ LQTLKYQLPQ 400
EPGCPTVLSV SPLDAASLGG SLTVLPATKE NMKHLSLQPF QKGFIIQPDS 450
SIVVKPISGE SAIELADIQQ ILKMAASAPP QISLPPLSKA PATPLQAIFK 500
HMPPLKPKPL VTPRTVVAAS TPPPLINAQQ ASPGCISPSL PPQSLKFLKG 550
SVEAVSNVHL LQSKSGIQPS TTTQLFLQQA GVELPGQPEM KTQLEQESII 600
EALLPLNMEA KIKQEITEGD LKAIMTGPSG KKTPAMRKVL YPCRFCNQVF 650
AFSGVLRAHV RSHLGISPYQ CNICDYIAAD KAALIRHIRT HSGERPYICK 700
ICHYPFTVKA NCERHLRKKH LKATRKDIEK NIEYVSSPTA ELVDAFCAPE 750
TVCRLCGEDL KHYRALRIHM RTHCSRGLGG CHKGRKPFEC KECNAPFVAK 800
RNCIHHILKQ HLHVPEKDIE SYVLATNSGL GPADTPTDAA SRGEEGSCVT 850
FAECKPLATF LEPQNGFLHS SPTQPLPSHI SVKLEPASSF AMDFNEPLDF 900
SQKGLALVQV KQENVSSLLT SSSSSALYDC SMEPIDLSIP KSVKKGDKDT 950
VVPSDAKKPE PEAGQAEPLS PRPPPCPTLS VTVEPKGSLE TPTGTVVAVT 1000
TAAKLEPHTQ PLQGSVQLAV PIYSPALVSN TPLLGNSAAL LNNPALLRPL 1050
RPKPPLLLPK PSMTEELPPL ASIAQIISSV SSAPTLLKTK VADPGPSITS 1100
SNTVATDSPG SSIPKAAATP TDTTSSKESS EPPPAASSPE EALPTEQGPA 1150
ATSSSRKRGR KRGLRNRPLP NSSAVDLDSS GEFASIEKML ATTDTNKFSP 1200
FLQTAEDDTQ EEVAGAPADQ HGPADEEQGS PAEDRLLRAK RNSYANCLQK 1250
INCPHCPRVF PWASSLQRHM LTHTDSQSDT DTLTTPGEVL DLTAQAKEQP 1300
PAEGASEISP ASQDLAIKEA KAAAAPSEEE EEKETEENPE PEEECRVEES 1350
TGAADAPEED TASNQSLDLD FATKLMDFKL AESEAGSVDS QGPAQQEPKH 1400
ACDTCGKNFK FLGTLSRHKK AHSCQEPKEE EAAAPSLENE GVGRAVEGPS 1450
PSPEPEEKPA ESLAIDPTPG TREASVAKQN EETEGPTDGE GTAEKRGDGD 1500
KRPKTDSPKS MASKADKRKK VCSVCNKRFW SLQDLTRHMR SHTGERPYKC 1550
QTCERTFTLK HSLVRHQRIH QKARHSKHHG KDSDKDERAE EDSEDESTHS 1600
ATNPASENEA ESAPSTSNHV AVTRSRKESL STSGKECSPE ERAAAEQAAE 1650
PSAPKEQASP GETDPQSPAA IVQDLLELCG KRPAPILAAT DGASQLLGME 1700
Length:1,700
Mass (Da):184,154
Last modified:July 10, 2007 - v2
Checksum:iDAB9246A566B1BC9
GO
Isoform 2 (identifier: Q3UH06-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:1,618
Mass (Da):175,402
Checksum:i52678CF395D69693
GO
Isoform 3 (identifier: Q3UH06-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1274-1274: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPPKESDVGSHDST

Show »
Length:1,754
Mass (Da):190,167
Checksum:iEE5F35416BEC03BC
GO
Isoform 4 (identifier: Q3UH06-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1275-1291: DSQSDTDTLTTPGEVLD → GKKALTAHQAVSLERKE
     1292-1700: Missing.

Show »
Length:1,291
Mass (Da):140,184
Checksum:i8AAF680E466B62B7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 2.
VSP_026765Add
BLAST
Alternative sequencei1274 – 12741T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPPKESDVGSHDST in isoform 3.
VSP_026766
Alternative sequencei1275 – 129117DSQSD…GEVLD → GKKALTAHQAVSLERKE in isoform 4.
VSP_026767Add
BLAST
Alternative sequencei1292 – 1700409Missing in isoform 4.
VSP_026768Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti834 – 8341D → G in BAE28051. 1 Publication
Sequence conflicti1113 – 11131I → T in AAH80680. 1 Publication
Sequence conflicti1178 – 11781D → G in BAE28051. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK147653 mRNA. Translation: BAE28051.1.
AK154980 mRNA. Translation: BAE32969.1.
AK171375 mRNA. Translation: BAE42417.1.
CT010477 Genomic DNA. Translation: CAX15920.1.
CT010477 Genomic DNA. Translation: CAX15921.1.
BC080680 mRNA. Translation: AAH80680.1.
AY946044 mRNA. Translation: AAX83010.1.
CCDSiCCDS36634.1. [Q3UH06-4]
CCDS49238.1. [Q3UH06-3]
RefSeqiNP_001034277.1. NM_001039188.1. [Q3UH06-4]
NP_001171339.1. NM_001177868.1. [Q3UH06-4]
NP_001171340.1. NM_001177869.1. [Q3UH06-3]
NP_081106.1. NM_026830.2. [Q3UH06-4]
XP_006516812.1. XM_006516749.1. [Q3UH06-3]
XP_006516813.1. XM_006516750.1. [Q3UH06-3]
XP_006516814.1. XM_006516751.1. [Q3UH06-3]
XP_006516815.1. XM_006516752.1. [Q3UH06-3]
XP_006516816.1. XM_006516753.1. [Q3UH06-3]
XP_006516817.1. XM_006516754.1. [Q3UH06-3]
XP_006516818.1. XM_006516755.1. [Q3UH06-3]
XP_006516819.1. XM_006516756.1. [Q3UH06-3]
XP_006516820.1. XM_006516757.1. [Q3UH06-3]
XP_006516822.1. XM_006516759.1. [Q3UH06-1]
UniGeneiMm.491109.

Genome annotation databases

EnsembliENSMUST00000037232; ENSMUSP00000049265; ENSMUSG00000039087. [Q3UH06-3]
ENSMUST00000110237; ENSMUSP00000105866; ENSMUSG00000039087. [Q3UH06-4]
ENSMUST00000110238; ENSMUSP00000105867; ENSMUSG00000039087. [Q3UH06-4]
ENSMUST00000128570; ENSMUSP00000115599; ENSMUSG00000039087. [Q3UH06-3]
ENSMUST00000149745; ENSMUSP00000121211; ENSMUSG00000039087. [Q3UH06-4]
GeneIDi68750.
KEGGimmu:68750.
UCSCiuc007qcw.2. mouse. [Q3UH06-4]
uc007qda.2. mouse. [Q3UH06-1]
uc007qdb.2. mouse. [Q3UH06-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK147653 mRNA. Translation: BAE28051.1 .
AK154980 mRNA. Translation: BAE32969.1 .
AK171375 mRNA. Translation: BAE42417.1 .
CT010477 Genomic DNA. Translation: CAX15920.1 .
CT010477 Genomic DNA. Translation: CAX15921.1 .
BC080680 mRNA. Translation: AAH80680.1 .
AY946044 mRNA. Translation: AAX83010.1 .
CCDSi CCDS36634.1. [Q3UH06-4 ]
CCDS49238.1. [Q3UH06-3 ]
RefSeqi NP_001034277.1. NM_001039188.1. [Q3UH06-4 ]
NP_001171339.1. NM_001177868.1. [Q3UH06-4 ]
NP_001171340.1. NM_001177869.1. [Q3UH06-3 ]
NP_081106.1. NM_026830.2. [Q3UH06-4 ]
XP_006516812.1. XM_006516749.1. [Q3UH06-3 ]
XP_006516813.1. XM_006516750.1. [Q3UH06-3 ]
XP_006516814.1. XM_006516751.1. [Q3UH06-3 ]
XP_006516815.1. XM_006516752.1. [Q3UH06-3 ]
XP_006516816.1. XM_006516753.1. [Q3UH06-3 ]
XP_006516817.1. XM_006516754.1. [Q3UH06-3 ]
XP_006516818.1. XM_006516755.1. [Q3UH06-3 ]
XP_006516819.1. XM_006516756.1. [Q3UH06-3 ]
XP_006516820.1. XM_006516757.1. [Q3UH06-3 ]
XP_006516822.1. XM_006516759.1. [Q3UH06-1 ]
UniGenei Mm.491109.

3D structure databases

ProteinModelPortali Q3UH06.
SMRi Q3UH06. Positions 66-257, 303-353, 606-806, 1522-1620.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000115599.

PTM databases

PhosphoSitei Q3UH06.

Proteomic databases

PaxDbi Q3UH06.
PRIDEi Q3UH06.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000037232 ; ENSMUSP00000049265 ; ENSMUSG00000039087 . [Q3UH06-3 ]
ENSMUST00000110237 ; ENSMUSP00000105866 ; ENSMUSG00000039087 . [Q3UH06-4 ]
ENSMUST00000110238 ; ENSMUSP00000105867 ; ENSMUSG00000039087 . [Q3UH06-4 ]
ENSMUST00000128570 ; ENSMUSP00000115599 ; ENSMUSG00000039087 . [Q3UH06-3 ]
ENSMUST00000149745 ; ENSMUSP00000121211 ; ENSMUSG00000039087 . [Q3UH06-4 ]
GeneIDi 68750.
KEGGi mmu:68750.
UCSCi uc007qcw.2. mouse. [Q3UH06-4 ]
uc007qda.2. mouse. [Q3UH06-1 ]
uc007qdb.2. mouse. [Q3UH06-3 ]

Organism-specific databases

CTDi 6239.
MGIi MGI:2443664. Rreb1.

Phylogenomic databases

eggNOGi NOG256116.
GeneTreei ENSGT00720000108795.
HOGENOMi HOG000154195.
HOVERGENi HBG108418.
OMAi ASIEKML.
OrthoDBi EOG7S21X0.
PhylomeDBi Q3UH06.
TreeFami TF332503.

Miscellaneous databases

ChiTaRSi RREB1. mouse.
NextBioi 327842.
PROi Q3UH06.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q3UH06.
Bgeei Q3UH06.
CleanExi MM_RREB1.
Genevestigatori Q3UH06.

Family and domain databases

Gene3Di 3.30.160.60. 8 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 15 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Strain: C57BL/6, C57BL/6J and NOD.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Embryo.
  4. "Role of mouse RREB gene in cancer susceptibility/resistance."
    Zhang S., Bliskovsky V., Mock B.
    Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 21-1700 (ISOFORM 3).
    Strain: BALB/c.
  5. "p16 INK4a gene promoter variation and differential binding of a repressor, the ras-responsive zinc-finger transcription factor, RREB."
    Zhang S., Qian X., Redman C., Bliskovski V., Ramsay E.S., Lowy D.R., Mock B.A.
    Oncogene 22:2285-2295(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1137; SER-1138; SER-1179 AND SER-1180, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiRREB1_MOUSE
AccessioniPrimary (citable) accession number: Q3UH06
Secondary accession number(s): B8JJE2
, B8JJE3, Q3TB97, Q4ZE88, Q66JZ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi