Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase Nek10

Gene

Nek10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei548 – 5481ATPPROSITE-ProRule annotationBy similarity
Active sitei655 – 6551Proton acceptorPROSITE-ProRule annotationBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi525 – 5339ATPPROSITE-ProRule annotationBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase Nek10 (EC:2.7.11.1)
Alternative name(s):
Never in mitosis A-related kinase 10
Short name:
NimA-related protein kinase 10
Gene namesi
Name:Nek10Imported
Synonyms:Gm282
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2685128. Nek10.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11111111Serine/threonine-protein kinase Nek10PRO_0000283794Add
BLAST

Proteomic databases

PaxDbiQ3UGM2.
PRIDEiQ3UGM2.

PTM databases

PhosphoSiteiQ3UGM2.

Expressioni

Gene expression databases

BgeeiQ3UGM2.
CleanExiMM_NEK10.
ExpressionAtlasiQ3UGM2. baseline and differential.

Interactioni

Protein-protein interaction databases

BioGridi586574. 2 interactions.
STRINGi10090.ENSMUSP00000108249.

Structurei

3D structure databases

ProteinModelPortaliQ3UGM2.
SMRiQ3UGM2. Positions 455-806.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini519 – 791273Protein kinasePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili481 – 51434Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0589. Eukaryota.
ENOG410Y7JF. LUCA.
GeneTreeiENSGT00760000118997.
HOGENOMiHOG000113762.
HOVERGENiHBG108180.
InParanoidiQ3UGM2.
KOiK08857.
OrthoDBiEOG7Q5HCF.
PhylomeDBiQ3UGM2.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008266. Tyr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00185. ARM. 4 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: Q3UGM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDQDTKAKS TEKTADKQQG TTTRDYSDLK RLRCLLNVQS SKQQLPAINF
60 70 80 90 100
DSAQNNMTKS EPTIRTGGHR ARGQWHESTE AVELENFSIN YKNERNFSKH
110 120 130 140 150
PQHQLFQEIF TALVRNRLIC REWVNRAPSI HFLRVLICLR LLMRDPCYQE
160 170 180 190 200
ILHKLGGIED LAQYMEIVAN EYLGYAEEQH CVDKLVNMTY IFQKLAAVKD
210 220 230 240 250
QREWVTASGA HKTLVSLLGA RDTTVLLGAL LALASLAESS ECREKISELN
260 270 280 290 300
VVENLLMILH EYDLLSKRLT AELLRLLCAE PQIKEQVKLY EGIPILLSLL
310 320 330 340 350
HSDHLKLLWS VIWILVQVCE DPETSVEIRI WGGIKQLLHI LQGDRNFVSD
360 370 380 390 400
RSSIGSLSSA NAAGRIQQLH LSEDLSPGEI EENTVSLQAA CCAALTELAL
410 420 430 440 450
NDTNAHQVVQ ENGVYTIAKL ILPNKQSNAA QTNLLQCYAF RTLRFLFSME
460 470 480 490 500
RNRPLFKRLF PTDLFETFID IGHYVRDIGA YKDLVSQLNL LLEDELKQIA
510 520 530 540 550
ENIESINQKK APLKYIGDYA VLDHLGSGAF GCVYKVRKRS GQNLLAMKEV
560 570 580 590 600
NLHNPAFGKD KKDRDSSVKN IVSELTIIKE QLYHPNVVRY YKTFLENDRL
610 620 630 640 650
YIVMELIEGA PLGEHFNSLK EKHHHFSEER LWKIFIQLCL ALRYLHKEKR
660 670 680 690 700
IVHRDLTPNN IMLGDKDKVT VTDFGLAKQK QESSKLTSMV GTILYSCPEV
710 720 730 740 750
LKSEPYGEKA DVWAAGCILY QMATLSPPFC STNMLSLATK IVEAVYEPVP
760 770 780 790 800
EGIYSEKVTD TIRRCLTPDA EARPDIVEVS SMISDVMMKY LDRLSTSQLA
810 820 830 840 850
LERKLERERR RTQRYFMEAN RNAVTCHHEL ALLSQETFEK ASLSSSSSGA
860 870 880 890 900
ASLKSELSES AELPGEGCHI PCGKEEDRVC EEVLSEDNFQ LESVEKDLYS
910 920 930 940 950
ELDDELDVSD NCSSSSSSPL KESTFSILKR SFSASGRERH SQARDFIAGL
960 970 980 990 1000
GSRPRPGPQM STFVVESASA GIAVSQRKVR QICDPIQQIL IQLHKVIYIT
1010 1020 1030 1040 1050
QLPPALHHDL KRRVIERFKK SLFSQQSNPC NLKSEIKKLS QGSPEPIELN
1060 1070 1080 1090 1100
FLTSDYHSLR HSRAANNWSP SDPTGSPSSF EVEEGVTYEQ MQTVIEEVLE
1110
ESGYYNFTTK R
Length:1,111
Mass (Da):126,058
Last modified:April 17, 2007 - v2
Checksum:iFBA45871F4EA2E98
GO
Isoform 21 Publication (identifier: Q3UGM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-603: Missing.
     957-1007: GPQMSTFVVESASAGIAVSQRKVRQICDPIQQILIQLHKVIYITQLPPALH → ALLPLHLLGKVPHQCPGTT

Note: No experimental confirmation available.Curated
Show »
Length:476
Mass (Da):53,683
Checksum:i77B8B728D9EC6B4F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 603603Missing in isoform 2. 1 PublicationVSP_052352Add
BLAST
Alternative sequencei957 – 100751GPQMS…PPALH → ALLPLHLLGKVPHQCPGTT in isoform 2. 1 PublicationVSP_052353Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147862 mRNA. Translation: BAE28185.1.
AC129580 Genomic DNA. No translation available.
RefSeqiNP_001182158.1. NM_001195229.1.
UniGeneiMm.317563.

Genome annotation databases

EnsembliENSMUST00000112631; ENSMUSP00000108250; ENSMUSG00000042567. [Q3UGM2-1]
GeneIDi674895.
KEGGimmu:674895.
UCSCiuc007sgs.2. mouse. [Q3UGM2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147862 mRNA. Translation: BAE28185.1.
AC129580 Genomic DNA. No translation available.
RefSeqiNP_001182158.1. NM_001195229.1.
UniGeneiMm.317563.

3D structure databases

ProteinModelPortaliQ3UGM2.
SMRiQ3UGM2. Positions 455-806.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi586574. 2 interactions.
STRINGi10090.ENSMUSP00000108249.

PTM databases

PhosphoSiteiQ3UGM2.

Proteomic databases

PaxDbiQ3UGM2.
PRIDEiQ3UGM2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000112631; ENSMUSP00000108250; ENSMUSG00000042567. [Q3UGM2-1]
GeneIDi674895.
KEGGimmu:674895.
UCSCiuc007sgs.2. mouse. [Q3UGM2-2]

Organism-specific databases

CTDi152110.
MGIiMGI:2685128. Nek10.

Phylogenomic databases

eggNOGiKOG0589. Eukaryota.
ENOG410Y7JF. LUCA.
GeneTreeiENSGT00760000118997.
HOGENOMiHOG000113762.
HOVERGENiHBG108180.
InParanoidiQ3UGM2.
KOiK08857.
OrthoDBiEOG7Q5HCF.
PhylomeDBiQ3UGM2.

Miscellaneous databases

PROiQ3UGM2.
SOURCEiSearch...

Gene expression databases

BgeeiQ3UGM2.
CleanExiMM_NEK10.
ExpressionAtlasiQ3UGM2. baseline and differential.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008266. Tyr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00185. ARM. 4 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Melanocyte.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.

Entry informationi

Entry nameiNEK10_MOUSE
AccessioniPrimary (citable) accession number: Q3UGM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: June 8, 2016
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.