Q3U8K7 (SV421_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 67.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase SUV420H1 EC=2.1.1.43 Alternative name(s): Suppressor of variegation 4-20 homolog 1 Short name=Su(var)4-20 homolog 1 Short name=Suv4-20h1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 883 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. SUV420H1 is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Ref.1 |
| Catalytic activity | S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone]. Ref.1 |
| Subunit structure | Interacts with HP1 proteins CBX1, CBX3 and CBX5. Interacts with RB1 family proteins RB1, RBL1 and RBL2. Ref.1 Ref.4 Ref.5 |
| Subcellular location | Nucleus. Chromosome. Note: Associated with pericentric heterochromatin. CBX1 and CBX5 are required for the localization to pericentric heterochromatin. Ref.1 |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. Suvar4-20 subfamily. Contains 1 SET domain. |
| Sequence caution | The sequence AAH11214.1 differs from that shown. Reason: Erroneous initiation. The sequence AAT00539.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC39834.1 differs from that shown. Reason: Erroneous initiation. The sequence BAE23934.1 differs from that shown. Reason: Erroneous termination at position 3. Translated as Trp. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Chromosome Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | S-adenosyl-L-methionine |
| Molecular function | Chromatin regulator Methyltransferase Repressor Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | histone H4-K20 trimethylation Inferred from electronic annotation. Source: InterPro regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | condensed nuclear chromosome, centromeric region Inferred from direct assay Ref.1. Source: MGI |
| Molecular_function | histone methyltransferase activity (H4-K20 specific) Inferred from direct assay Ref.1. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3U8K7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3U8K7-2) The sequence of this isoform differs from the canonical sequence as follows: 393-394: TS → SK 395-883: Missing. | ||||||
| Isoform 3 (identifier: Q3U8K7-3) The sequence of this isoform differs from the canonical sequence as follows: 104-126: Missing. | ||||||
| Isoform 4 (identifier: Q3U8K7-4) The sequence of this isoform differs from the canonical sequence as follows: 328-883: Missing. | ||||||
| Isoform 5 (identifier: Q3U8K7-5) The sequence of this isoform differs from the canonical sequence as follows: 104-126: Missing. 831-883: EGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA → SGKAAEANCW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 883 | 883 | Histone-lysine N-methyltransferase SUV420H1 | PRO_0000281788 | |||||
Regions | |||||||||
| Domain | 194 – 313 | 120 | SET | ||||||
Natural variations | |||||||||
| Alternative sequence | 104 – 126 | 23 | Missing in isoform 3 and isoform 5. | VSP_024053 | |||||
| Alternative sequence | 328 – 883 | 556 | Missing in isoform 4. | VSP_024054 | |||||
| Alternative sequence | 393 – 394 | 2 | TS → SK in isoform 2. | VSP_024055 | |||||
| Alternative sequence | 395 – 883 | 489 | Missing in isoform 2. | VSP_024056 | |||||
| Alternative sequence | 831 – 883 | 53 | EGEEE…LRLNA → SGKAAEANCW in isoform 5. | VSP_024057 | |||||
Experimental info | |||||||||
| Sequence conflict | 53 | 1 | S → N in AAH75709. Ref.3 | ||||||
| Sequence conflict | 153 | 1 | K → E in AAH11214. Ref.2 | ||||||
| Sequence conflict | 292 | 1 | V → L in BAC39834. Ref.1 | ||||||
| Sequence conflict | 328 | 1 | R → Q in BAE31010. Ref.2 | ||||||
| Sequence conflict | 428 | 1 | P → A in AAH75709. Ref.3 | ||||||
| Sequence conflict | 472 | 1 | E → G in BAC38817. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | N → S in AAH75709. Ref.3 | ||||||
| Sequence conflict | 590 | 1 | P → H in BAC38817. Ref.1 | ||||||
| Sequence conflict | 595 | 1 | R → G in BAE31010. Ref.2 | ||||||
| Sequence conflict | 664 | 1 | H → Y in AAH75709. Ref.3 | ||||||
| Sequence conflict | 678 | 1 | A → T in AAH75709. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A silencing pathway to induce H3-K9 and H4-K20 trimethylation at constitutive heterochromatin." Schotta G., Lachner M., Sarma K., Ebert A., Sengupta R., Reuter G., Reinberg D., Jenuwein T. Genes Dev. 18:1251-1262(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH CBX1; CBX3 AND CBX5. Strain: C57BL/6. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.  Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Strain: C57BL/6J. Tissue: Bone marrow, Cerebellum, Hippocampus, Lung, Oviduct and Vagina. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). Strain: Czech II and FVB/N. Tissue: Mammary tumor and Salivary gland. |
| [4] | "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin." Gonzalo S., Garcia-Cao M., Fraga M.F., Schotta G., Peters A.H.F.M., Cotter S.E., Eguia R., Dean D.C., Esteller M., Jenuwein T., Blasco M.A. Nat. Cell Biol. 7:420-428(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RB1; RBL1 AND RBL2. |
| [5] | "The retinoblastoma protein regulates pericentric heterochromatin." Isaac C.E., Francis S.M., Martens A.L., Julian L.M., Seifried L.A., Erdmann N., Binne U.K., Harrington L., Sicinski P., Berube N.G., Dyson N.J., Dick F.A. Mol. Cell. Biol. 26:3659-3671(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RB1; RBL1 AND RBL2. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | SV421_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3U8K7 Secondary accession number(s): Q3UTP6 Q91X81 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |