SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3U8K7

- SV421_MOUSE

UniProt

Q3U8K7 - SV421_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Histone-lysine N-methyltransferase SUV420H1
Gene
Suv420h1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. SUV420H1 is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2).1 Publication

Catalytic activityi

S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].1 Publication

GO - Molecular functioni

  1. histone methyltransferase activity (H4-K20 specific) Source: MGI
Complete GO annotation...

GO - Biological processi

  1. histone H4-K20 trimethylation Source: InterPro
  2. histone methylation Source: MGI
  3. regulation of transcription, DNA-templated Source: UniProtKB-KW
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Methyltransferase, Repressor, Transferase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Histone-lysine N-methyltransferase SUV420H1 (EC:2.1.1.43)
Alternative name(s):
Suppressor of variegation 4-20 homolog 1
Short name:
Su(var)4-20 homolog 1
Short name:
Suv4-20h1
Gene namesi
Name:Suv420h1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:2444557. Suv420h1.

Subcellular locationi

Nucleus. Chromosome
Note: Associated with pericentric heterochromatin. CBX1 and CBX5 are required for the localization to pericentric heterochromatin.1 Publication

GO - Cellular componenti

  1. condensed nuclear chromosome, centromeric region Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 883883Histone-lysine N-methyltransferase SUV420H1
PRO_0000281788Add
BLAST

Proteomic databases

PaxDbiQ3U8K7.
PRIDEiQ3U8K7.

PTM databases

PhosphoSiteiQ3U8K7.

Expressioni

Gene expression databases

ArrayExpressiQ3U8K7.
BgeeiQ3U8K7.
GenevestigatoriQ3U8K7.

Interactioni

Subunit structurei

Interacts with HP1 proteins CBX1, CBX3 and CBX5. Interacts with RB1 family proteins RB1, RBL1 and RBL2.3 Publications

Protein-protein interaction databases

BioGridi230441. 3 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi75 – 8915
Helixi91 – 944
Helixi138 – 14811
Helixi151 – 1588
Helixi173 – 18715
Helixi188 – 1903
Beta strandi196 – 2016
Beta strandi208 – 21710
Beta strandi224 – 23512
Helixi237 – 2437
Turni246 – 2483
Beta strandi253 – 2564
Turni257 – 2604
Beta strandi261 – 2677
Helixi268 – 2714
Beta strandi279 – 29618
Turni310 – 3134
Helixi315 – 3173
Helixi323 – 3286
Helixi331 – 3333

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4BUPX-ray2.17A/B70-336[»]
ProteinModelPortaliQ3U8K7.
SMRiQ3U8K7. Positions 72-334.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini194 – 309116SET
Add
BLAST

Sequence similaritiesi

Contains 1 SET domain.

Phylogenomic databases

eggNOGiNOG240704.
GeneTreeiENSGT00520000055640.
HOVERGENiHBG105761.
InParanoidiQ3U8K7.
KOiK11429.
OMAiKLEMGNL.
OrthoDBiEOG7MKW6P.
PhylomeDBiQ3U8K7.
TreeFamiTF106433.

Family and domain databases

InterProiIPR025790. Hist-Lys_N-MTase_Suvar4-20.
IPR001214. SET_dom.
[Graphical view]
PfamiPF00856. SET. 1 hit.
[Graphical view]
SMARTiSM00317. SET. 1 hit.
[Graphical view]
PROSITEiPS51570. SAM_MT43_SUVAR420_2. 1 hit.
PS50280. SET. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3U8K7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKWLGDSKNM VVNGRRNGGK LSNDHQQNQS KLQQHSGKDT LKTGRNAVER    50
RSSRCHGNSG FEGQSRYVPS SGMSAKELCE NDDLATSLVL DPYLGFQTHK 100
MNTSAFPSRS SRHISKADSF SHNNPVRFRP IKGRQEELKE VIERFKKDEH 150
LEKAFKCLTS GEWARHYFLN KNKMQEKLFK EHVFIYLRMF ATDSGFEILP 200
CNRYSSEQNG AKIVATKEWK RNDKIELLVG CIAELSEIEE NMLLRHGEND 250
FSVMYSTRKN CAQLWLGPAA FINHDCRPNC KFVSTGRDTA CVKALRDIEP 300
GEEISCYYGD GFFGENNEFC ECYTCERRGT GAFKSRVGLP APAPVINSKY 350
GLRETDKRLN RLKKLGDSSK NSDSQSVSSN TDADTTQEKD NATSNRKSSV 400
GVKKSSKSRA LTRPSMPRVP AASNSTSPKL VHTNNPRVPK KLRKPAKPLL 450
SKIRLRNHCK RLDQKSASRK LEMGSLVLKE PKVVLYKNLP IKKEREPEGP 500
AHAAVGSGCL TRHAAREHRQ NHGRGAHSQG DSLPCTYTTR RSLRTRTGLK 550
ETTDIKLEPS PLDGYKNGIL EPCPDSGQQP TPEVLEELAP ETAHREEASQ 600
ECPKNDSCLS RKKFRQVKPV KHLAKTEDCS PEHSFPGKDG LPDLPGSHPD 650
QGEPSGTVRV PVSHTDSAPS PVGCSVVAPD SFTKDSFRTA QSKKKRRVTR 700
YDAQLILENS SGIPKLTLRR RHDSSSKTND HESDGVNSSK ISIKLSKDHD 750
SDSNLYVAKL SNGVSAGPGS SSTKLKIQLK RDEESRGPCA EGLHENGVCC 800
SDPLSLLESQ MEVDDYSQYE EDSTDESSSS EGEEEEEDCE DDFDDDFIPL 850
PPAKRLRLIV GKDSIDIDIS SRRREDQSLR LNA 883
Length:883
Mass (Da):98,580
Last modified:April 3, 2007 - v2
Checksum:i2B24461F582CC5F1
GO
Isoform 2 (identifier: Q3U8K7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     393-394: TS → SK
     395-883: Missing.

Show »
Length:394
Mass (Da):44,723
Checksum:i1425ECDBE1F767D7
GO
Isoform 3 (identifier: Q3U8K7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-126: Missing.

Show »
Length:860
Mass (Da):96,070
Checksum:i2EEE457CEE91A890
GO
Isoform 4 (identifier: Q3U8K7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-883: Missing.

Show »
Length:327
Mass (Da):37,546
Checksum:i6400D6AAEEA26B99
GO
Isoform 5 (identifier: Q3U8K7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-126: Missing.
     831-883: EGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA → SGKAAEANCW

Note: No experimental confirmation available.

Show »
Length:817
Mass (Da):90,944
Checksum:i478C772F2EAFDEC4
GO

Sequence cautioni

The sequence AAH11214.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAT00539.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAC39834.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAE23934.1 differs from that shown. Reason: Erroneous termination at position 3. Translated as Trp.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei104 – 12623Missing in isoform 3 and isoform 5.
VSP_024053Add
BLAST
Alternative sequencei328 – 883556Missing in isoform 4.
VSP_024054Add
BLAST
Alternative sequencei393 – 3942TS → SK in isoform 2.
VSP_024055
Alternative sequencei395 – 883489Missing in isoform 2.
VSP_024056Add
BLAST
Alternative sequencei831 – 88353EGEEE…LRLNA → SGKAAEANCW in isoform 5.
VSP_024057Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti53 – 531S → N in AAH75709. 1 Publication
Sequence conflicti153 – 1531K → E in AAH11214. 1 Publication
Sequence conflicti292 – 2921V → L in BAC39834. 1 Publication
Sequence conflicti328 – 3281R → Q in BAE31010. 1 Publication
Sequence conflicti428 – 4281P → A in AAH75709. 1 Publication
Sequence conflicti472 – 4721E → G in BAC38817. 1 Publication
Sequence conflicti521 – 5211N → S in AAH75709. 1 Publication
Sequence conflicti590 – 5901P → H in BAC38817. 1 Publication
Sequence conflicti595 – 5951R → G in BAE31010. 1 Publication
Sequence conflicti664 – 6641H → Y in AAH75709. 1 Publication
Sequence conflicti678 – 6781A → T in AAH75709. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY555192 mRNA. Translation: AAT00539.1. Different initiation.
AK036880 mRNA. Translation: BAC29617.1.
AK054093 mRNA. Translation: BAC35652.1.
AK082660 mRNA. Translation: BAC38565.1.
AK083227 mRNA. Translation: BAC38817.1.
AK087267 mRNA. Translation: BAC39834.1. Different initiation.
AK139255 mRNA. Translation: BAE23934.1. Sequence problems.
AK152179 mRNA. Translation: BAE31010.1.
BC011214 mRNA. Translation: AAH11214.1. Different initiation.
BC075709 mRNA. Translation: AAH75709.1.
CCDSiCCDS29399.1. [Q3U8K7-3]
CCDS50343.1. [Q3U8K7-1]
CCDS50344.1. [Q3U8K7-2]
CCDS50345.1. [Q3U8K7-4]
RefSeqiNP_001161356.1. NM_001167884.1. [Q3U8K7-4]
NP_001161357.1. NM_001167885.1. [Q3U8K7-1]
NP_001161358.1. NM_001167886.1. [Q3U8K7-3]
NP_001161359.1. NM_001167887.1. [Q3U8K7-1]
NP_001161360.1. NM_001167888.1. [Q3U8K7-4]
NP_001161361.1. NM_001167889.1. [Q3U8K7-2]
NP_659120.3. NM_144871.4. [Q3U8K7-3]
XP_006531790.1. XM_006531727.1. [Q3U8K7-1]
XP_006531791.1. XM_006531728.1. [Q3U8K7-1]
XP_006531794.1. XM_006531731.1. [Q3U8K7-5]
UniGeneiMm.278578.

Genome annotation databases

EnsembliENSMUST00000005518; ENSMUSP00000005518; ENSMUSG00000045098. [Q3U8K7-4]
ENSMUST00000052699; ENSMUSP00000060162; ENSMUSG00000045098. [Q3U8K7-2]
ENSMUST00000113967; ENSMUSP00000109600; ENSMUSG00000045098. [Q3U8K7-4]
ENSMUST00000113968; ENSMUSP00000109601; ENSMUSG00000045098. [Q3U8K7-4]
ENSMUST00000113970; ENSMUSP00000109603; ENSMUSG00000045098. [Q3U8K7-2]
ENSMUST00000113972; ENSMUSP00000109605; ENSMUSG00000045098. [Q3U8K7-1]
ENSMUST00000113973; ENSMUSP00000109606; ENSMUSG00000045098. [Q3U8K7-1]
ENSMUST00000113974; ENSMUSP00000109607; ENSMUSG00000045098. [Q3U8K7-3]
ENSMUST00000113977; ENSMUSP00000109610; ENSMUSG00000045098. [Q3U8K7-3]
ENSMUST00000176262; ENSMUSP00000135563; ENSMUSG00000045098. [Q3U8K7-3]
GeneIDi225888.
KEGGimmu:225888.
UCSCiuc008fww.2. mouse. [Q3U8K7-4]
uc008fwz.2. mouse. [Q3U8K7-2]
uc008fxa.2. mouse. [Q3U8K7-1]
uc008fxc.2. mouse. [Q3U8K7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY555192 mRNA. Translation: AAT00539.1 . Different initiation.
AK036880 mRNA. Translation: BAC29617.1 .
AK054093 mRNA. Translation: BAC35652.1 .
AK082660 mRNA. Translation: BAC38565.1 .
AK083227 mRNA. Translation: BAC38817.1 .
AK087267 mRNA. Translation: BAC39834.1 . Different initiation.
AK139255 mRNA. Translation: BAE23934.1 . Sequence problems.
AK152179 mRNA. Translation: BAE31010.1 .
BC011214 mRNA. Translation: AAH11214.1 . Different initiation.
BC075709 mRNA. Translation: AAH75709.1 .
CCDSi CCDS29399.1. [Q3U8K7-3 ]
CCDS50343.1. [Q3U8K7-1 ]
CCDS50344.1. [Q3U8K7-2 ]
CCDS50345.1. [Q3U8K7-4 ]
RefSeqi NP_001161356.1. NM_001167884.1. [Q3U8K7-4 ]
NP_001161357.1. NM_001167885.1. [Q3U8K7-1 ]
NP_001161358.1. NM_001167886.1. [Q3U8K7-3 ]
NP_001161359.1. NM_001167887.1. [Q3U8K7-1 ]
NP_001161360.1. NM_001167888.1. [Q3U8K7-4 ]
NP_001161361.1. NM_001167889.1. [Q3U8K7-2 ]
NP_659120.3. NM_144871.4. [Q3U8K7-3 ]
XP_006531790.1. XM_006531727.1. [Q3U8K7-1 ]
XP_006531791.1. XM_006531728.1. [Q3U8K7-1 ]
XP_006531794.1. XM_006531731.1. [Q3U8K7-5 ]
UniGenei Mm.278578.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4BUP X-ray 2.17 A/B 70-336 [» ]
ProteinModelPortali Q3U8K7.
SMRi Q3U8K7. Positions 72-334.
ModBasei Search...

Protein-protein interaction databases

BioGridi 230441. 3 interactions.

PTM databases

PhosphoSitei Q3U8K7.

Proteomic databases

PaxDbi Q3U8K7.
PRIDEi Q3U8K7.

Protocols and materials databases

DNASUi 225888.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000005518 ; ENSMUSP00000005518 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
ENSMUST00000052699 ; ENSMUSP00000060162 ; ENSMUSG00000045098 . [Q3U8K7-2 ]
ENSMUST00000113967 ; ENSMUSP00000109600 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
ENSMUST00000113968 ; ENSMUSP00000109601 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
ENSMUST00000113970 ; ENSMUSP00000109603 ; ENSMUSG00000045098 . [Q3U8K7-2 ]
ENSMUST00000113972 ; ENSMUSP00000109605 ; ENSMUSG00000045098 . [Q3U8K7-1 ]
ENSMUST00000113973 ; ENSMUSP00000109606 ; ENSMUSG00000045098 . [Q3U8K7-1 ]
ENSMUST00000113974 ; ENSMUSP00000109607 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
ENSMUST00000113977 ; ENSMUSP00000109610 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
ENSMUST00000176262 ; ENSMUSP00000135563 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
GeneIDi 225888.
KEGGi mmu:225888.
UCSCi uc008fww.2. mouse. [Q3U8K7-4 ]
uc008fwz.2. mouse. [Q3U8K7-2 ]
uc008fxa.2. mouse. [Q3U8K7-1 ]
uc008fxc.2. mouse. [Q3U8K7-3 ]

Organism-specific databases

CTDi 51111.
MGIi MGI:2444557. Suv420h1.

Phylogenomic databases

eggNOGi NOG240704.
GeneTreei ENSGT00520000055640.
HOVERGENi HBG105761.
InParanoidi Q3U8K7.
KOi K11429.
OMAi KLEMGNL.
OrthoDBi EOG7MKW6P.
PhylomeDBi Q3U8K7.
TreeFami TF106433.

Miscellaneous databases

ChiTaRSi SUV420H1. mouse.
NextBioi 377853.
PROi Q3U8K7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q3U8K7.
Bgeei Q3U8K7.
Genevestigatori Q3U8K7.

Family and domain databases

InterProi IPR025790. Hist-Lys_N-MTase_Suvar4-20.
IPR001214. SET_dom.
[Graphical view ]
Pfami PF00856. SET. 1 hit.
[Graphical view ]
SMARTi SM00317. SET. 1 hit.
[Graphical view ]
PROSITEi PS51570. SAM_MT43_SUVAR420_2. 1 hit.
PS50280. SET. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A silencing pathway to induce H3-K9 and H4-K20 trimethylation at constitutive heterochromatin."
    Schotta G., Lachner M., Sarma K., Ebert A., Sengupta R., Reuter G., Reinberg D., Jenuwein T.
    Genes Dev. 18:1251-1262(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH CBX1; CBX3 AND CBX5.
    Strain: C57BL/6.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Bone marrow, Cerebellum, Hippocampus, Lung, Oviduct and Vagina.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor and Salivary gland.
  4. "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin."
    Gonzalo S., Garcia-Cao M., Fraga M.F., Schotta G., Peters A.H.F.M., Cotter S.E., Eguia R., Dean D.C., Esteller M., Jenuwein T., Blasco M.A.
    Nat. Cell Biol. 7:420-428(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RB1; RBL1 AND RBL2.
  5. Cited for: INTERACTION WITH RB1; RBL1 AND RBL2.

Entry informationi

Entry nameiSV421_MOUSE
AccessioniPrimary (citable) accession number: Q3U8K7
Secondary accession number(s): Q3UTP6
, Q6DI74, Q6Q784, Q8BU67, Q8BUN0, Q8BUT7, Q8BW73, Q8BZ24, Q91X81
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: July 9, 2014
This is version 77 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi