Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3U8K7

- SV421_MOUSE

UniProt

Q3U8K7 - SV421_MOUSE

Protein

Histone-lysine N-methyltransferase SUV420H1

Gene

Suv420h1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 78 (01 Oct 2014)
      Sequence version 2 (03 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. SUV420H1 is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Plays a role in myogenesis by regulating the expression of target genes, such as EID3.2 Publications

    Catalytic activityi

    S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].1 PublicationPROSITE-ProRule annotation

    GO - Molecular functioni

    1. histone methyltransferase activity (H4-K20 specific) Source: MGI

    GO - Biological processi

    1. histone H4-K20 trimethylation Source: InterPro
    2. histone methylation Source: MGI
    3. regulation of transcription, DNA-templated Source: UniProtKB-KW
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chromatin regulator, Methyltransferase, Repressor, Transferase

    Keywords - Biological processi

    Myogenesis, Transcription, Transcription regulation

    Keywords - Ligandi

    S-adenosyl-L-methionine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Histone-lysine N-methyltransferase SUV420H1 (EC:2.1.1.43)
    Alternative name(s):
    Suppressor of variegation 4-20 homolog 1
    Short name:
    Su(var)4-20 homolog 1
    Short name:
    Suv4-20h1
    Gene namesi
    Name:Suv420h1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 19

    Organism-specific databases

    MGIiMGI:2444557. Suv420h1.

    Subcellular locationi

    Nucleus 1 Publication. Chromosome 1 Publication
    Note: Associated with pericentric heterochromatin. CBX1 and CBX5 are required for the localization to pericentric heterochromatin.

    GO - Cellular componenti

    1. condensed nuclear chromosome, centromeric region Source: MGI

    Keywords - Cellular componenti

    Chromosome, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Partial muscle-specific knockout mice display several signs of muscular dystrophy including necrosis and an increased number of centrally nucleated myofibers. RNAi-mediated knockdown in C2C12 muscle cells causes reduced myogenic differentation of the cells.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 883883Histone-lysine N-methyltransferase SUV420H1PRO_0000281788Add
    BLAST

    Proteomic databases

    PaxDbiQ3U8K7.
    PRIDEiQ3U8K7.

    PTM databases

    PhosphoSiteiQ3U8K7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ3U8K7.
    BgeeiQ3U8K7.
    GenevestigatoriQ3U8K7.

    Interactioni

    Subunit structurei

    Interacts with HP1 proteins CBX1, CBX3 and CBX5. Interacts with RB1 family proteins RB1, RBL1 and RBL2. Interacts (via C-terminus) with FRG1.4 Publications

    Protein-protein interaction databases

    BioGridi230441. 3 interactions.

    Structurei

    Secondary structure

    1
    883
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi75 – 8915
    Helixi91 – 944
    Helixi138 – 14811
    Helixi151 – 1588
    Helixi173 – 18715
    Helixi188 – 1903
    Beta strandi196 – 2016
    Beta strandi208 – 21710
    Beta strandi224 – 23512
    Helixi237 – 2437
    Turni246 – 2483
    Beta strandi253 – 2564
    Turni257 – 2604
    Beta strandi261 – 2677
    Helixi268 – 2714
    Beta strandi279 – 29618
    Turni310 – 3134
    Helixi315 – 3173
    Helixi323 – 3286
    Helixi331 – 3333

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4BUPX-ray2.17A/B70-336[»]
    ProteinModelPortaliQ3U8K7.
    SMRiQ3U8K7. Positions 72-334.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini194 – 309116SETPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar4-20 subfamily.PROSITE-ProRule annotation
    Contains 1 SET domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG240704.
    GeneTreeiENSGT00520000055640.
    HOVERGENiHBG105761.
    InParanoidiQ3U8K7.
    KOiK11429.
    OMAiKLEMGNL.
    OrthoDBiEOG7MKW6P.
    PhylomeDBiQ3U8K7.
    TreeFamiTF106433.

    Family and domain databases

    InterProiIPR025790. Hist-Lys_N-MTase_Suvar4-20.
    IPR001214. SET_dom.
    [Graphical view]
    PfamiPF00856. SET. 1 hit.
    [Graphical view]
    SMARTiSM00317. SET. 1 hit.
    [Graphical view]
    PROSITEiPS51570. SAM_MT43_SUVAR420_2. 1 hit.
    PS50280. SET. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q3U8K7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKWLGDSKNM VVNGRRNGGK LSNDHQQNQS KLQQHSGKDT LKTGRNAVER    50
    RSSRCHGNSG FEGQSRYVPS SGMSAKELCE NDDLATSLVL DPYLGFQTHK 100
    MNTSAFPSRS SRHISKADSF SHNNPVRFRP IKGRQEELKE VIERFKKDEH 150
    LEKAFKCLTS GEWARHYFLN KNKMQEKLFK EHVFIYLRMF ATDSGFEILP 200
    CNRYSSEQNG AKIVATKEWK RNDKIELLVG CIAELSEIEE NMLLRHGEND 250
    FSVMYSTRKN CAQLWLGPAA FINHDCRPNC KFVSTGRDTA CVKALRDIEP 300
    GEEISCYYGD GFFGENNEFC ECYTCERRGT GAFKSRVGLP APAPVINSKY 350
    GLRETDKRLN RLKKLGDSSK NSDSQSVSSN TDADTTQEKD NATSNRKSSV 400
    GVKKSSKSRA LTRPSMPRVP AASNSTSPKL VHTNNPRVPK KLRKPAKPLL 450
    SKIRLRNHCK RLDQKSASRK LEMGSLVLKE PKVVLYKNLP IKKEREPEGP 500
    AHAAVGSGCL TRHAAREHRQ NHGRGAHSQG DSLPCTYTTR RSLRTRTGLK 550
    ETTDIKLEPS PLDGYKNGIL EPCPDSGQQP TPEVLEELAP ETAHREEASQ 600
    ECPKNDSCLS RKKFRQVKPV KHLAKTEDCS PEHSFPGKDG LPDLPGSHPD 650
    QGEPSGTVRV PVSHTDSAPS PVGCSVVAPD SFTKDSFRTA QSKKKRRVTR 700
    YDAQLILENS SGIPKLTLRR RHDSSSKTND HESDGVNSSK ISIKLSKDHD 750
    SDSNLYVAKL SNGVSAGPGS SSTKLKIQLK RDEESRGPCA EGLHENGVCC 800
    SDPLSLLESQ MEVDDYSQYE EDSTDESSSS EGEEEEEDCE DDFDDDFIPL 850
    PPAKRLRLIV GKDSIDIDIS SRRREDQSLR LNA 883
    Length:883
    Mass (Da):98,580
    Last modified:April 3, 2007 - v2
    Checksum:i2B24461F582CC5F1
    GO
    Isoform 2 (identifier: Q3U8K7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         393-394: TS → SK
         395-883: Missing.

    Show »
    Length:394
    Mass (Da):44,723
    Checksum:i1425ECDBE1F767D7
    GO
    Isoform 3 (identifier: Q3U8K7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         104-126: Missing.

    Show »
    Length:860
    Mass (Da):96,070
    Checksum:i2EEE457CEE91A890
    GO
    Isoform 4 (identifier: Q3U8K7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-883: Missing.

    Show »
    Length:327
    Mass (Da):37,546
    Checksum:i6400D6AAEEA26B99
    GO
    Isoform 5 (identifier: Q3U8K7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         104-126: Missing.
         831-883: EGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA → SGKAAEANCW

    Note: No experimental confirmation available.

    Show »
    Length:817
    Mass (Da):90,944
    Checksum:i478C772F2EAFDEC4
    GO

    Sequence cautioni

    The sequence AAH11214.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAT00539.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC39834.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAE23934.1 differs from that shown. Reason: Erroneous termination at position 3. Translated as Trp.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti53 – 531S → N in AAH75709. (PubMed:15489334)Curated
    Sequence conflicti153 – 1531K → E in AAH11214. (PubMed:16141072)Curated
    Sequence conflicti292 – 2921V → L in BAC39834. (PubMed:15145825)Curated
    Sequence conflicti328 – 3281R → Q in BAE31010. (PubMed:16141072)Curated
    Sequence conflicti428 – 4281P → A in AAH75709. (PubMed:15489334)Curated
    Sequence conflicti472 – 4721E → G in BAC38817. (PubMed:15145825)Curated
    Sequence conflicti521 – 5211N → S in AAH75709. (PubMed:15489334)Curated
    Sequence conflicti590 – 5901P → H in BAC38817. (PubMed:15145825)Curated
    Sequence conflicti595 – 5951R → G in BAE31010. (PubMed:16141072)Curated
    Sequence conflicti664 – 6641H → Y in AAH75709. (PubMed:15489334)Curated
    Sequence conflicti678 – 6781A → T in AAH75709. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei104 – 12623Missing in isoform 3 and isoform 5. 2 PublicationsVSP_024053Add
    BLAST
    Alternative sequencei328 – 883556Missing in isoform 4. 2 PublicationsVSP_024054Add
    BLAST
    Alternative sequencei393 – 3942TS → SK in isoform 2. 1 PublicationVSP_024055
    Alternative sequencei395 – 883489Missing in isoform 2. 1 PublicationVSP_024056Add
    BLAST
    Alternative sequencei831 – 88353EGEEE…LRLNA → SGKAAEANCW in isoform 5. 1 PublicationVSP_024057Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY555192 mRNA. Translation: AAT00539.1. Different initiation.
    AK036880 mRNA. Translation: BAC29617.1.
    AK054093 mRNA. Translation: BAC35652.1.
    AK082660 mRNA. Translation: BAC38565.1.
    AK083227 mRNA. Translation: BAC38817.1.
    AK087267 mRNA. Translation: BAC39834.1. Different initiation.
    AK139255 mRNA. Translation: BAE23934.1. Sequence problems.
    AK152179 mRNA. Translation: BAE31010.1.
    BC011214 mRNA. Translation: AAH11214.1. Different initiation.
    BC075709 mRNA. Translation: AAH75709.1.
    CCDSiCCDS29399.1. [Q3U8K7-3]
    CCDS50343.1. [Q3U8K7-1]
    CCDS50344.1. [Q3U8K7-2]
    CCDS50345.1. [Q3U8K7-4]
    RefSeqiNP_001161356.1. NM_001167884.1. [Q3U8K7-4]
    NP_001161357.1. NM_001167885.1. [Q3U8K7-1]
    NP_001161358.1. NM_001167886.1. [Q3U8K7-3]
    NP_001161359.1. NM_001167887.1. [Q3U8K7-1]
    NP_001161360.1. NM_001167888.1. [Q3U8K7-4]
    NP_001161361.1. NM_001167889.1. [Q3U8K7-2]
    NP_659120.3. NM_144871.4. [Q3U8K7-3]
    XP_006531790.1. XM_006531727.1. [Q3U8K7-1]
    XP_006531791.1. XM_006531728.1. [Q3U8K7-1]
    XP_006531794.1. XM_006531731.1. [Q3U8K7-5]
    UniGeneiMm.278578.

    Genome annotation databases

    EnsembliENSMUST00000005518; ENSMUSP00000005518; ENSMUSG00000045098. [Q3U8K7-4]
    ENSMUST00000052699; ENSMUSP00000060162; ENSMUSG00000045098. [Q3U8K7-2]
    ENSMUST00000113967; ENSMUSP00000109600; ENSMUSG00000045098. [Q3U8K7-4]
    ENSMUST00000113968; ENSMUSP00000109601; ENSMUSG00000045098. [Q3U8K7-4]
    ENSMUST00000113970; ENSMUSP00000109603; ENSMUSG00000045098. [Q3U8K7-2]
    ENSMUST00000113972; ENSMUSP00000109605; ENSMUSG00000045098. [Q3U8K7-1]
    ENSMUST00000113973; ENSMUSP00000109606; ENSMUSG00000045098. [Q3U8K7-1]
    ENSMUST00000113974; ENSMUSP00000109607; ENSMUSG00000045098. [Q3U8K7-3]
    ENSMUST00000113977; ENSMUSP00000109610; ENSMUSG00000045098. [Q3U8K7-3]
    ENSMUST00000176262; ENSMUSP00000135563; ENSMUSG00000045098. [Q3U8K7-3]
    GeneIDi225888.
    KEGGimmu:225888.
    UCSCiuc008fww.2. mouse. [Q3U8K7-4]
    uc008fwz.2. mouse. [Q3U8K7-2]
    uc008fxa.2. mouse. [Q3U8K7-1]
    uc008fxc.2. mouse. [Q3U8K7-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY555192 mRNA. Translation: AAT00539.1 . Different initiation.
    AK036880 mRNA. Translation: BAC29617.1 .
    AK054093 mRNA. Translation: BAC35652.1 .
    AK082660 mRNA. Translation: BAC38565.1 .
    AK083227 mRNA. Translation: BAC38817.1 .
    AK087267 mRNA. Translation: BAC39834.1 . Different initiation.
    AK139255 mRNA. Translation: BAE23934.1 . Sequence problems.
    AK152179 mRNA. Translation: BAE31010.1 .
    BC011214 mRNA. Translation: AAH11214.1 . Different initiation.
    BC075709 mRNA. Translation: AAH75709.1 .
    CCDSi CCDS29399.1. [Q3U8K7-3 ]
    CCDS50343.1. [Q3U8K7-1 ]
    CCDS50344.1. [Q3U8K7-2 ]
    CCDS50345.1. [Q3U8K7-4 ]
    RefSeqi NP_001161356.1. NM_001167884.1. [Q3U8K7-4 ]
    NP_001161357.1. NM_001167885.1. [Q3U8K7-1 ]
    NP_001161358.1. NM_001167886.1. [Q3U8K7-3 ]
    NP_001161359.1. NM_001167887.1. [Q3U8K7-1 ]
    NP_001161360.1. NM_001167888.1. [Q3U8K7-4 ]
    NP_001161361.1. NM_001167889.1. [Q3U8K7-2 ]
    NP_659120.3. NM_144871.4. [Q3U8K7-3 ]
    XP_006531790.1. XM_006531727.1. [Q3U8K7-1 ]
    XP_006531791.1. XM_006531728.1. [Q3U8K7-1 ]
    XP_006531794.1. XM_006531731.1. [Q3U8K7-5 ]
    UniGenei Mm.278578.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4BUP X-ray 2.17 A/B 70-336 [» ]
    ProteinModelPortali Q3U8K7.
    SMRi Q3U8K7. Positions 72-334.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 230441. 3 interactions.

    PTM databases

    PhosphoSitei Q3U8K7.

    Proteomic databases

    PaxDbi Q3U8K7.
    PRIDEi Q3U8K7.

    Protocols and materials databases

    DNASUi 225888.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000005518 ; ENSMUSP00000005518 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
    ENSMUST00000052699 ; ENSMUSP00000060162 ; ENSMUSG00000045098 . [Q3U8K7-2 ]
    ENSMUST00000113967 ; ENSMUSP00000109600 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
    ENSMUST00000113968 ; ENSMUSP00000109601 ; ENSMUSG00000045098 . [Q3U8K7-4 ]
    ENSMUST00000113970 ; ENSMUSP00000109603 ; ENSMUSG00000045098 . [Q3U8K7-2 ]
    ENSMUST00000113972 ; ENSMUSP00000109605 ; ENSMUSG00000045098 . [Q3U8K7-1 ]
    ENSMUST00000113973 ; ENSMUSP00000109606 ; ENSMUSG00000045098 . [Q3U8K7-1 ]
    ENSMUST00000113974 ; ENSMUSP00000109607 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
    ENSMUST00000113977 ; ENSMUSP00000109610 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
    ENSMUST00000176262 ; ENSMUSP00000135563 ; ENSMUSG00000045098 . [Q3U8K7-3 ]
    GeneIDi 225888.
    KEGGi mmu:225888.
    UCSCi uc008fww.2. mouse. [Q3U8K7-4 ]
    uc008fwz.2. mouse. [Q3U8K7-2 ]
    uc008fxa.2. mouse. [Q3U8K7-1 ]
    uc008fxc.2. mouse. [Q3U8K7-3 ]

    Organism-specific databases

    CTDi 51111.
    MGIi MGI:2444557. Suv420h1.

    Phylogenomic databases

    eggNOGi NOG240704.
    GeneTreei ENSGT00520000055640.
    HOVERGENi HBG105761.
    InParanoidi Q3U8K7.
    KOi K11429.
    OMAi KLEMGNL.
    OrthoDBi EOG7MKW6P.
    PhylomeDBi Q3U8K7.
    TreeFami TF106433.

    Miscellaneous databases

    ChiTaRSi SUV420H1. mouse.
    NextBioi 377853.
    PROi Q3U8K7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q3U8K7.
    Bgeei Q3U8K7.
    Genevestigatori Q3U8K7.

    Family and domain databases

    InterProi IPR025790. Hist-Lys_N-MTase_Suvar4-20.
    IPR001214. SET_dom.
    [Graphical view ]
    Pfami PF00856. SET. 1 hit.
    [Graphical view ]
    SMARTi SM00317. SET. 1 hit.
    [Graphical view ]
    PROSITEi PS51570. SAM_MT43_SUVAR420_2. 1 hit.
    PS50280. SET. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A silencing pathway to induce H3-K9 and H4-K20 trimethylation at constitutive heterochromatin."
      Schotta G., Lachner M., Sarma K., Ebert A., Sengupta R., Reuter G., Reinberg D., Jenuwein T.
      Genes Dev. 18:1251-1262(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH CBX1; CBX3 AND CBX5.
      Strain: C57BL/6.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Bone marrow, Cerebellum, Hippocampus, Lung, Oviduct and Vagina.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
      Strain: Czech II and FVB/N.
      Tissue: Mammary tumor and Salivary gland.
    4. "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin."
      Gonzalo S., Garcia-Cao M., Fraga M.F., Schotta G., Peters A.H.F.M., Cotter S.E., Eguia R., Dean D.C., Esteller M., Jenuwein T., Blasco M.A.
      Nat. Cell Biol. 7:420-428(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RB1; RBL1 AND RBL2.
    5. Cited for: INTERACTION WITH RB1; RBL1 AND RBL2.
    6. "FSHD muscular dystrophy region gene 1 binds Suv4-20h1 histone methyltransferase and impairs myogenesis."
      Neguembor M.V., Xynos A., Onorati M.C., Caccia R., Bortolanza S., Godio C., Pistoni M., Corona D.F., Schotta G., Gabellini D.
      J. Mol. Cell Biol. 5:294-307(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH FRG1, DISRUPTION PHENOTYPE.

    Entry informationi

    Entry nameiSV421_MOUSE
    AccessioniPrimary (citable) accession number: Q3U8K7
    Secondary accession number(s): Q3UTP6
    , Q6DI74, Q6Q784, Q8BU67, Q8BUN0, Q8BUT7, Q8BW73, Q8BZ24, Q91X81
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: April 3, 2007
    Last modified: October 1, 2014
    This is version 78 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3