Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphoinositide 3-kinase regulatory subunit 6

Gene

Pik3r6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G proteins than PIK3CG:PIK3R5 and its membrane recruitment and beta-gamma G protein dimer-dependent activation requires HRAS bound to PIK3CG. Recruits of the PI3K gamma complex to a PDE3B:RAPGEF3 signaling complex involved in angiogenesis; signaling seems to involve RRAS.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Angiogenesis

Enzyme and pathway databases

BRENDAi2.7.1.137. 3474.
ReactomeiR-MMU-114604. GPVI-mediated activation cascade.
R-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-392451. G beta:gamma signalling through PI3Kgamma.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphoinositide 3-kinase regulatory subunit 6
Alternative name(s):
Phosphoinositide 3-kinase gamma adapter protein of 87 kDa
p84 PI3K adapter protein
Short name:
p84 PIKAP
p87 PI3K adapter protein
Short name:
p87PIKAP
Gene namesi
Name:Pik3r6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2144613. Pik3r6.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • membrane Source: UniProtKB
  • phosphatidylinositol 3-kinase complex, class IB Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002343391 – 756Phosphoinositide 3-kinase regulatory subunit 6Add BLAST756

Proteomic databases

PaxDbiQ3U6Q4.
PRIDEiQ3U6Q4.

PTM databases

iPTMnetiQ3U6Q4.
PhosphoSitePlusiQ3U6Q4.

Expressioni

Tissue specificityi

Highly expressed in heart. In a lower extent, also expressed in brain, spleen, lung, liver, kidney, prostate, thyroid, salivary gland, dendritic cells, macrophages and neutrophils.1 Publication

Gene expression databases

BgeeiENSMUSG00000046207.
CleanExiMM_PIK3R6.
GenevisibleiQ3U6Q4. MM.

Interactioni

Subunit structurei

Heterodimer of a catalytic subunit (PIK3CG) and a regulatory (PIK3R6) subunit. The binding of PIK3R6 to PIK3CG may exclude the binding of PIK3R5 to PIK3CG. Interacts with beta-gamma G protein dimers. Interacts with PDE3B; the interaction allows recruitment of the PI3K gamma complex to a PDE3B:RAPGEF3 complex.2 Publications

Protein-protein interaction databases

DIPiDIP-60179N.
IntActiQ3U6Q4. 3 interactors.
STRINGi10090.ENSMUSP00000052522.

Structurei

3D structure databases

ProteinModelPortaliQ3U6Q4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410ITTQ. Eukaryota.
ENOG41103E9. LUCA.
GeneTreeiENSGT00530000063753.
HOGENOMiHOG000115540.
HOVERGENiHBG080761.
InParanoidiQ3U6Q4.
OMAiIQDSKFP.
OrthoDBiEOG091G0339.
PhylomeDBiQ3U6Q4.
TreeFamiTF102035.

Family and domain databases

InterProiIPR019522. PIK3R5/6.
[Graphical view]
PfamiPF10486. PI3K_1B_p101. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3U6Q4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESSDVELDF QRSVQAVLRE LNTPNPALQS NQGMWRWSLH KKVERNPGKS
60 70 80 90 100
SILVRILLRE LEKAESEDGR RVIIPLLLTL MSVLTKATGI PEDLYHRAYT
110 120 130 140 150
FCTRLLTLPA PYSTVALDCA IRLKTETAVP GTLYQRTVIA EQNLISELYP
160 170 180 190 200
YQERVFLFVD PELVSASVCS ALLLEIQAAQ EQQTPEACMR HVVSHALQAA
210 220 230 240 250
LGEACHTGAL NRKLQASSRR VLEYYFHAVV AAIEQVASED SPSRLGHLEK
260 270 280 290 300
MEEIYCSLLG PATTRRHCVG DLLQDRLPSI PLPSPYITFH LWTDQEQLWK
310 320 330 340 350
ELVLFLRPRS QLRLSADLDA LDLQGFRLDR DLARVSTDSG IERDLPLGSD
360 370 380 390 400
ELPDPSSSEM ERAALQRKGG IKKRVWPPDF FMPGSWDGPP GLHRRTGRPS
410 420 430 440 450
GDGELLPGVS RVHTARVLVL GDDRMLGRLA QAYYRLRKRE TKKFCLTPRL
460 470 480 490 500
SLQLYYIPVL APQVTGQDPE ASRKPELGEL ASFLGRVDPW YESTVNTLCP
510 520 530 540 550
AILKLAEMPP YLDTSRTVDP FILDVITYYV RMGTQPIYFQ LYKVKIFTSL
560 570 580 590 600
SHDPTEDIFL TELKVKIQDS KSPKEGSSPR RRGAAEGTGA ELSMCYQKAL
610 620 630 640 650
LSHRPREVTV SLRATGLVLK AIPAGDTEVS GFFHCTSPNA ASATDCSCLH
660 670 680 690 700
VSVTEVVKSS NLAGRSFTTS TNTFRTSSIQ VQSQDQRLLT LWLDKDGRRT
710 720 730 740 750
FRDVVRFEVS PCPEPCSRTQ KSKTSALNSH GQETEKNMAK PNSLLMPINT

FSGIIQ
Length:756
Mass (Da):84,663
Last modified:October 11, 2005 - v1
Checksum:i5F3B56982C514876
GO
Isoform 2 (identifier: Q3U6Q4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-466: Missing.

Show »
Length:752
Mass (Da):84,278
Checksum:i962135DD5874843C
GO
Isoform 3 (identifier: Q3U6Q4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-305: DLLQDRLPSIPLPSPYITFHLWTDQEQLWKELVLF → KRGPAGDLPRETAIRRGGRQRARLDRMRFPEEPED
     306-756: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):34,315
Checksum:iE165638D90D34871
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti710S → G in BAE30180 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018255271 – 305DLLQD…ELVLF → KRGPAGDLPRETAIRRGGRQ RARLDRMRFPEEPED in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_018256306 – 756Missing in isoform 3. 1 PublicationAdd BLAST451
Alternative sequenceiVSP_018257463 – 466Missing in isoform 2. 2 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY753194 mRNA. Translation: AAV30089.1.
DQ295832 mRNA. Translation: ABB97395.1.
AK151178 mRNA. Translation: BAE30180.1.
AK153039 mRNA. Translation: BAE31670.1.
AK171063 mRNA. Translation: BAE42222.1.
BC028998 mRNA. Translation: AAH28998.1.
AL606831 Genomic DNA. Translation: CAI25693.1.
CCDSiCCDS24866.1. [Q3U6Q4-2]
CCDS36186.1. [Q3U6Q4-1]
RefSeqiNP_001004435.1. NM_001004435.3. [Q3U6Q4-2]
NP_001075035.1. NM_001081566.2. [Q3U6Q4-1]
UniGeneiMm.234573.

Genome annotation databases

EnsembliENSMUST00000060441; ENSMUSP00000052522; ENSMUSG00000046207. [Q3U6Q4-1]
ENSMUST00000102613; ENSMUSP00000099673; ENSMUSG00000046207. [Q3U6Q4-2]
GeneIDi104709.
KEGGimmu:104709.
UCSCiuc007jnq.1. mouse. [Q3U6Q4-3]
uc007jnr.2. mouse. [Q3U6Q4-1]
uc007jns.2. mouse. [Q3U6Q4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY753194 mRNA. Translation: AAV30089.1.
DQ295832 mRNA. Translation: ABB97395.1.
AK151178 mRNA. Translation: BAE30180.1.
AK153039 mRNA. Translation: BAE31670.1.
AK171063 mRNA. Translation: BAE42222.1.
BC028998 mRNA. Translation: AAH28998.1.
AL606831 Genomic DNA. Translation: CAI25693.1.
CCDSiCCDS24866.1. [Q3U6Q4-2]
CCDS36186.1. [Q3U6Q4-1]
RefSeqiNP_001004435.1. NM_001004435.3. [Q3U6Q4-2]
NP_001075035.1. NM_001081566.2. [Q3U6Q4-1]
UniGeneiMm.234573.

3D structure databases

ProteinModelPortaliQ3U6Q4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-60179N.
IntActiQ3U6Q4. 3 interactors.
STRINGi10090.ENSMUSP00000052522.

PTM databases

iPTMnetiQ3U6Q4.
PhosphoSitePlusiQ3U6Q4.

Proteomic databases

PaxDbiQ3U6Q4.
PRIDEiQ3U6Q4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000060441; ENSMUSP00000052522; ENSMUSG00000046207. [Q3U6Q4-1]
ENSMUST00000102613; ENSMUSP00000099673; ENSMUSG00000046207. [Q3U6Q4-2]
GeneIDi104709.
KEGGimmu:104709.
UCSCiuc007jnq.1. mouse. [Q3U6Q4-3]
uc007jnr.2. mouse. [Q3U6Q4-1]
uc007jns.2. mouse. [Q3U6Q4-2]

Organism-specific databases

CTDi146850.
MGIiMGI:2144613. Pik3r6.

Phylogenomic databases

eggNOGiENOG410ITTQ. Eukaryota.
ENOG41103E9. LUCA.
GeneTreeiENSGT00530000063753.
HOGENOMiHOG000115540.
HOVERGENiHBG080761.
InParanoidiQ3U6Q4.
OMAiIQDSKFP.
OrthoDBiEOG091G0339.
PhylomeDBiQ3U6Q4.
TreeFamiTF102035.

Enzyme and pathway databases

BRENDAi2.7.1.137. 3474.
ReactomeiR-MMU-114604. GPVI-mediated activation cascade.
R-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-392451. G beta:gamma signalling through PI3Kgamma.

Miscellaneous databases

PROiQ3U6Q4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000046207.
CleanExiMM_PIK3R6.
GenevisibleiQ3U6Q4. MM.

Family and domain databases

InterProiIPR019522. PIK3R5/6.
[Graphical view]
PfamiPF10486. PI3K_1B_p101. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPI3R6_MOUSE
AccessioniPrimary (citable) accession number: Q3U6Q4
Secondary accession number(s): Q3TBT5, Q3UAY4, Q8K323
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 11, 2005
Last modified: November 30, 2016
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.