SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3U4H6

- HEXDC_MOUSE

UniProt

Q3U4H6 - HEXDC_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Hexosaminidase D
Gene
Hexdc
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Has hexosaminidase activity.1 Publication

Catalytic activityi

Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.1 Publication

Enzyme regulationi

Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc).1 Publication

Kineticsi

  1. KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide1 Publication

pH dependencei

Optimum pH is 5.5.

Temperature dependencei

Optimum temperature is 37 degrees Celsius.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei149 – 1491Proton donor By similarity

GO - Molecular functioni

  1. beta-N-acetylhexosaminidase activity Source: UniProtKB-EC

GO - Biological processi

  1. carbohydrate metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

SABIO-RKQ3U4H6.

Protein family/group databases

CAZyiGH20. Glycoside Hydrolase Family 20.

Names & Taxonomyi

Protein namesi
Recommended name:
Hexosaminidase D (EC:3.2.1.52)
Alternative name(s):
Beta-N-acetylhexosaminidase
Beta-hexosaminidase D
Hexosaminidase domain-containing protein
N-acetyl-beta-galactosaminidase
Gene namesi
Name:Hexdc
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:3605542. Hexdc.

Subcellular locationi

Cytoplasm. Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 486486Hexosaminidase D
PRO_0000316791Add
BLAST

Keywords - PTMi

Disulfide bond

Proteomic databases

PRIDEiQ3U4H6.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

ArrayExpressiQ3U4H6.
BgeeiQ3U4H6.
GenevestigatoriQ3U4H6.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ3U4H6.
SMRiQ3U4H6. Positions 50-415.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG72156.
GeneTreeiENSGT00390000014852.
HOGENOMiHOG000047740.
HOVERGENiHBG061201.
InParanoidiQ3U4H6.
KOiK14459.
OMAiVENIYID.
TreeFamiTF314313.

Family and domain databases

Gene3Di3.20.20.80. 1 hit.
InterProiIPR015883. Glyco_hydro_20_cat-core.
IPR013781. Glyco_hydro_catalytic_dom.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PfamiPF00728. Glyco_hydro_20. 1 hit.
[Graphical view]
SUPFAMiSSF51445. SSF51445. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3U4H6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSPTPFKMR LVHLDLKGAP PKVSYLSEVF PLFHALGANG LLIEYEDMFP    50
YEGHLRLLRA KHAYSPSEVT EILRLARLSE LEVIPLVQTF GHMEFVLKHA 100
AFAHLREVAL FPNTLNPHEA ESLALVQAMI DQILELHRDV RWLHIGCDEV 150
YYLGEGETSK QWLQQEQNSH AKLCLSHMQA VASHVLTQHP GVTPLVWDDM 200
LRDIPQEQLK ASGVPQLVEP VLWDYGADLD VHGKVFLIGK YQECGFQRLW 250
AASAFKGATG ASQALPPVEH HIRNHELWLQ VAGSGPKDAL QGIILTGWQR 300
YDHFSVLCEL LPVGIPSLAA CLQSLVHGGF AEDVRLRAER FLGVSSLEIA 350
DTVSEGAGSF PGSDIHALVT QISLHLRSSV DTLLERNRYV TGWFSPYHRR 400
RKLVHPVMIQ HIQPEALSLL SRWNNLVQQL EVALQPVFYP DTIEEWLEEN 450
VLPSLQRLQD LLQDLGEAAA RQPPPTSPGW DTGQNP 486
Length:486
Mass (Da):54,576
Last modified:October 11, 2005 - v1
Checksum:i8F8EFEB55BB0350F
GO
Isoform 2 (identifier: Q3U4H6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG

Note: No experimental confirmation available.

Show »
Length:559
Mass (Da):62,221
Checksum:i22DE3999197B42BE
GO

Sequence cautioni

The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei328 – 3281G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2.
VSP_030778

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FM204885 mRNA. Translation: CAR57923.1.
FM204886 mRNA. Translation: CAR57924.1.
AK154237 mRNA. Translation: BAE32455.1.
AL808021 Genomic DNA. Translation: CAM21737.1.
BC069960 mRNA. Translation: AAH69960.1. Different initiation.
CCDSiCCDS49013.1. [Q3U4H6-1]
RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
XP_006533327.1. XM_006533264.1. [Q3U4H6-2]
XP_006533328.1. XM_006533265.1. [Q3U4H6-2]
XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
XP_006533331.1. XM_006533268.1. [Q3U4H6-2]
XP_006533332.1. XM_006533269.1. [Q3U4H6-2]
UniGeneiMm.275130.

Genome annotation databases

EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
GeneIDi238023.
KEGGimmu:238023.
UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
uc007mvm.2. mouse. [Q3U4H6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FM204885 mRNA. Translation: CAR57923.1 .
FM204886 mRNA. Translation: CAR57924.1 .
AK154237 mRNA. Translation: BAE32455.1 .
AL808021 Genomic DNA. Translation: CAM21737.1 .
BC069960 mRNA. Translation: AAH69960.1 . Different initiation.
CCDSi CCDS49013.1. [Q3U4H6-1 ]
RefSeqi NP_001001333.2. NM_001001333.2. [Q3U4H6-1 ]
NP_001139545.1. NM_001146073.1. [Q3U4H6-2 ]
XP_006533327.1. XM_006533264.1. [Q3U4H6-2 ]
XP_006533328.1. XM_006533265.1. [Q3U4H6-2 ]
XP_006533329.1. XM_006533266.1. [Q3U4H6-2 ]
XP_006533330.1. XM_006533267.1. [Q3U4H6-2 ]
XP_006533331.1. XM_006533268.1. [Q3U4H6-2 ]
XP_006533332.1. XM_006533269.1. [Q3U4H6-2 ]
UniGenei Mm.275130.

3D structure databases

ProteinModelPortali Q3U4H6.
SMRi Q3U4H6. Positions 50-415.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

CAZyi GH20. Glycoside Hydrolase Family 20.

Proteomic databases

PRIDEi Q3U4H6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000038831 ; ENSMUSP00000048479 ; ENSMUSG00000039307 . [Q3U4H6-2 ]
ENSMUST00000106117 ; ENSMUSP00000101723 ; ENSMUSG00000039307 . [Q3U4H6-1 ]
GeneIDi 238023.
KEGGi mmu:238023.
UCSCi uc007mvl.2. mouse. [Q3U4H6-1 ]
uc007mvm.2. mouse. [Q3U4H6-2 ]

Organism-specific databases

CTDi 284004.
MGIi MGI:3605542. Hexdc.

Phylogenomic databases

eggNOGi NOG72156.
GeneTreei ENSGT00390000014852.
HOGENOMi HOG000047740.
HOVERGENi HBG061201.
InParanoidi Q3U4H6.
KOi K14459.
OMAi VENIYID.
TreeFami TF314313.

Enzyme and pathway databases

SABIO-RK Q3U4H6.

Miscellaneous databases

NextBioi 383640.
PROi Q3U4H6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q3U4H6.
Bgeei Q3U4H6.
Genevestigatori Q3U4H6.

Family and domain databases

Gene3Di 3.20.20.80. 1 hit.
InterProi IPR015883. Glyco_hydro_20_cat-core.
IPR013781. Glyco_hydro_catalytic_dom.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view ]
Pfami PF00728. Glyco_hydro_20. 1 hit.
[Graphical view ]
SUPFAMi SSF51445. SSF51445. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Mammalian cells contain a second nucleocytoplasmic hexosaminidase."
    Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B.
    Biochem. J. 419:83-90(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Liver.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: NOD.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2).
    Strain: FVB/N-3.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiHEXDC_MOUSE
AccessioniPrimary (citable) accession number: Q3U4H6
Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 11, 2005
Last modified: July 9, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi