Q3U4H6 (HEXDC_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Hexosaminidase D EC=3.2.1.52 Alternative name(s): Beta-N-acetylhexosaminidase Beta-hexosaminidase D Hexosaminidase domain-containing protein N-acetyl-beta-galactosaminidase | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 486 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has hexosaminidase activity. Ref.1 |
| Catalytic activity | Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. Ref.1 |
| Enzyme regulation | Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc). Ref.1 |
| Subunit structure | Homodimer; disulfide-linked. Ref.1 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.1 |
| Sequence similarities | Belongs to the glycosyl hydrolase 20 family. |
| Biophysicochemical properties | Kinetic parameters: KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide Ref.1 pH dependence: Optimum pH is 5.5. Temperature dependence: Optimum temperature is 37 degrees Celsius. |
| Sequence caution | The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Glycosidase Hydrolase |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | carbohydrate metabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | beta-N-acetylhexosaminidase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3U4H6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3U4H6-2) The sequence of this isoform differs from the canonical sequence as follows: 328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 486 | 486 | Hexosaminidase D | PRO_0000316791 | |||||
Sites | |||||||||
| Active site | 149 | 1 | Proton donor By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 328 | 1 | G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2. | VSP_030778 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian cells contain a second nucleocytoplasmic hexosaminidase." Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B. Biochem. J. 419:83-90(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Liver. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: NOD. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2). Strain: FVB/N-3. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | FM204885 mRNA. Translation: CAR57923.1. FM204886 mRNA. Translation: CAR57924.1. AK154237 mRNA. Translation: BAE32455.1. AL808021 Genomic DNA. Translation: CAM21737.1. BC069960 mRNA. Translation: AAH69960.1. Different initiation. |
| IPI | IPI00416066. IPI00648146. |
| RefSeq | NP_001001333.2. NM_001001333.2. NP_001139545.1. NM_001146073.1. |
| UniGene | Mm.275130. |
3D structure databases | |
| ProteinModelPortal | Q3U4H6. |
| SMR | Q3U4H6. Positions 50-415. |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GH20. Glycoside Hydrolase Family 20. |
Proteomic databases | |
| PRIDE | Q3U4H6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. |
| GeneID | 238023. |
| KEGG | mmu:238023. |
| UCSC | uc007mvl.2. mouse. uc007mvm.2. mouse. |
Organism-specific databases | |
| CTD | 284004. |
| MGI | MGI:3605542. Hexdc. |
Phylogenomic databases | |
| eggNOG | NOG72156. |
| GeneTree | ENSGT00390000014852. |
| HOGENOM | HOG000047740. |
| HOVERGEN | HBG061201. |
| InParanoid | Q3U4H6. |
| KO | K14459. |
| OMA | KLIHPVM. |
Enzyme and pathway databases | |
| SABIO-RK | Q3U4H6. |
Gene expression databases | |
| ArrayExpress | Q3U4H6. |
| Bgee | Q3U4H6. |
| Genevestigator | Q3U4H6. |
Family and domain databases | |
| Gene3D | 3.20.20.80. 1 hit. |
| InterPro | IPR015883. Glyco_hydro_20_cat-core. IPR013781. Glyco_hydro_catalytic_dom. IPR017853. Glycoside_hydrolase_SF. [Graphical view] |
| Pfam | PF00728. Glyco_hydro_20. 1 hit. [Graphical view] |
| SUPFAM | SSF51445. Glyco_hydro_cat. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 383640. |
| SOURCE | Search... |
Entry information
| Entry name | HEXDC_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3U4H6 Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
