Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hexosaminidase D

Gene

Hexdc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has hexosaminidase activity.1 Publication

Catalytic activityi

Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.1 Publication

Enzyme regulationi

Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc).1 Publication

Kineticsi

  1. KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide1 Publication

    pH dependencei

    Optimum pH is 5.5.1 Publication

    Temperature dependencei

    Optimum temperature is 37 degrees Celsius.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei149 – 1491Proton donorBy similarity

    GO - Molecular functioni

    GO - Biological processi

    Complete GO annotation...

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Enzyme and pathway databases

    BRENDAi3.2.1.52. 3474.
    SABIO-RKQ3U4H6.

    Protein family/group databases

    CAZyiGH20. Glycoside Hydrolase Family 20.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Hexosaminidase D (EC:3.2.1.52)
    Alternative name(s):
    Beta-N-acetylhexosaminidase
    Beta-hexosaminidase D
    Hexosaminidase domain-containing protein
    N-acetyl-beta-galactosaminidase
    Gene namesi
    Name:Hexdc
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589 Componenti: Chromosome 11

    Organism-specific databases

    MGIiMGI:3605542. Hexdc.

    Subcellular locationi

    • Cytoplasm 1 Publication
    • Nucleus 1 Publication

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 486486Hexosaminidase DPRO_0000316791Add
    BLAST

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    MaxQBiQ3U4H6.
    PRIDEiQ3U4H6.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    BgeeiQ3U4H6.
    ExpressionAtlasiQ3U4H6. baseline.
    GenevisibleiQ3U4H6. MM.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ3U4H6.
    SMRiQ3U4H6. Positions 50-415.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 20 family.Curated

    Phylogenomic databases

    eggNOGiNOG72156.
    GeneTreeiENSGT00390000014852.
    HOGENOMiHOG000047740.
    HOVERGENiHBG061201.
    InParanoidiQ3U4H6.
    KOiK14459.
    OMAiDMMASAM.
    TreeFamiTF314313.

    Family and domain databases

    Gene3Di3.20.20.80. 1 hit.
    InterProiIPR015883. Glyco_hydro_20_cat-core.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view]
    PfamiPF00728. Glyco_hydro_20. 1 hit.
    [Graphical view]
    SUPFAMiSSF51445. SSF51445. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q3U4H6-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MSSPTPFKMR LVHLDLKGAP PKVSYLSEVF PLFHALGANG LLIEYEDMFP
    60 70 80 90 100
    YEGHLRLLRA KHAYSPSEVT EILRLARLSE LEVIPLVQTF GHMEFVLKHA
    110 120 130 140 150
    AFAHLREVAL FPNTLNPHEA ESLALVQAMI DQILELHRDV RWLHIGCDEV
    160 170 180 190 200
    YYLGEGETSK QWLQQEQNSH AKLCLSHMQA VASHVLTQHP GVTPLVWDDM
    210 220 230 240 250
    LRDIPQEQLK ASGVPQLVEP VLWDYGADLD VHGKVFLIGK YQECGFQRLW
    260 270 280 290 300
    AASAFKGATG ASQALPPVEH HIRNHELWLQ VAGSGPKDAL QGIILTGWQR
    310 320 330 340 350
    YDHFSVLCEL LPVGIPSLAA CLQSLVHGGF AEDVRLRAER FLGVSSLEIA
    360 370 380 390 400
    DTVSEGAGSF PGSDIHALVT QISLHLRSSV DTLLERNRYV TGWFSPYHRR
    410 420 430 440 450
    RKLVHPVMIQ HIQPEALSLL SRWNNLVQQL EVALQPVFYP DTIEEWLEEN
    460 470 480
    VLPSLQRLQD LLQDLGEAAA RQPPPTSPGW DTGQNP
    Length:486
    Mass (Da):54,576
    Last modified:October 11, 2005 - v1
    Checksum:i8F8EFEB55BB0350F
    GO
    Isoform 2 (identifier: Q3U4H6-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG

    Note: No experimental confirmation available.
    Show »
    Length:559
    Mass (Da):62,221
    Checksum:i22DE3999197B42BE
    GO

    Sequence cautioni

    The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation. Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei328 – 3281G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2. 2 PublicationsVSP_030778

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    FM204885 mRNA. Translation: CAR57923.1.
    FM204886 mRNA. Translation: CAR57924.1.
    AK154237 mRNA. Translation: BAE32455.1.
    AL808021 Genomic DNA. Translation: CAM21737.1.
    BC069960 mRNA. Translation: AAH69960.1. Different initiation.
    CCDSiCCDS49013.1. [Q3U4H6-1]
    RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
    NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
    XP_006533327.1. XM_006533264.2. [Q3U4H6-2]
    XP_006533328.1. XM_006533265.2. [Q3U4H6-2]
    XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
    XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
    XP_006533331.1. XM_006533268.2. [Q3U4H6-2]
    XP_006533332.1. XM_006533269.2. [Q3U4H6-2]
    UniGeneiMm.275130.

    Genome annotation databases

    EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
    ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
    GeneIDi238023.
    KEGGimmu:238023.
    UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
    uc007mvm.2. mouse. [Q3U4H6-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    FM204885 mRNA. Translation: CAR57923.1.
    FM204886 mRNA. Translation: CAR57924.1.
    AK154237 mRNA. Translation: BAE32455.1.
    AL808021 Genomic DNA. Translation: CAM21737.1.
    BC069960 mRNA. Translation: AAH69960.1. Different initiation.
    CCDSiCCDS49013.1. [Q3U4H6-1]
    RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
    NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
    XP_006533327.1. XM_006533264.2. [Q3U4H6-2]
    XP_006533328.1. XM_006533265.2. [Q3U4H6-2]
    XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
    XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
    XP_006533331.1. XM_006533268.2. [Q3U4H6-2]
    XP_006533332.1. XM_006533269.2. [Q3U4H6-2]
    UniGeneiMm.275130.

    3D structure databases

    ProteinModelPortaliQ3U4H6.
    SMRiQ3U4H6. Positions 50-415.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein family/group databases

    CAZyiGH20. Glycoside Hydrolase Family 20.

    Proteomic databases

    MaxQBiQ3U4H6.
    PRIDEiQ3U4H6.

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
    ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
    GeneIDi238023.
    KEGGimmu:238023.
    UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
    uc007mvm.2. mouse. [Q3U4H6-2]

    Organism-specific databases

    CTDi284004.
    MGIiMGI:3605542. Hexdc.

    Phylogenomic databases

    eggNOGiNOG72156.
    GeneTreeiENSGT00390000014852.
    HOGENOMiHOG000047740.
    HOVERGENiHBG061201.
    InParanoidiQ3U4H6.
    KOiK14459.
    OMAiDMMASAM.
    TreeFamiTF314313.

    Enzyme and pathway databases

    BRENDAi3.2.1.52. 3474.
    SABIO-RKQ3U4H6.

    Miscellaneous databases

    NextBioi383640.
    PROiQ3U4H6.
    SOURCEiSearch...

    Gene expression databases

    BgeeiQ3U4H6.
    ExpressionAtlasiQ3U4H6. baseline.
    GenevisibleiQ3U4H6. MM.

    Family and domain databases

    Gene3Di3.20.20.80. 1 hit.
    InterProiIPR015883. Glyco_hydro_20_cat-core.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view]
    PfamiPF00728. Glyco_hydro_20. 1 hit.
    [Graphical view]
    SUPFAMiSSF51445. SSF51445. 1 hit.
    ProtoNetiSearch...

    Publicationsi

    « Hide 'large scale' publications
    1. "Mammalian cells contain a second nucleocytoplasmic hexosaminidase."
      Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B.
      Biochem. J. 419:83-90(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Liver.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: NOD.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2).
      Strain: FVB/N-3.
      Tissue: Mammary tumor.

    Entry informationi

    Entry nameiHEXDC_MOUSE
    AccessioniPrimary (citable) accession number: Q3U4H6
    Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: October 11, 2005
    Last modified: July 22, 2015
    This is version 81 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.