Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hexosaminidase D

Gene

Hexdc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has hexosaminidase activity.1 Publication

Catalytic activityi

Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.1 Publication

Enzyme regulationi

Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc).1 Publication

Kineticsi

  1. KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide1 Publication

pH dependencei

Optimum pH is 5.5.1 Publication

Temperature dependencei

Optimum temperature is 37 degrees Celsius.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei149 – 1491Proton donorBy similarity

GO - Molecular functioni

  1. beta-N-acetylhexosaminidase activity Source: UniProtKB-EC

GO - Biological processi

  1. carbohydrate metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

BRENDAi3.2.1.52. 3474.
SABIO-RKQ3U4H6.

Protein family/group databases

CAZyiGH20. Glycoside Hydrolase Family 20.

Names & Taxonomyi

Protein namesi
Recommended name:
Hexosaminidase D (EC:3.2.1.52)
Alternative name(s):
Beta-N-acetylhexosaminidase
Beta-hexosaminidase D
Hexosaminidase domain-containing protein
N-acetyl-beta-galactosaminidase
Gene namesi
Name:Hexdc
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:3605542. Hexdc.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 486486Hexosaminidase DPRO_0000316791Add
BLAST

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiQ3U4H6.
PRIDEiQ3U4H6.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiQ3U4H6.
ExpressionAtlasiQ3U4H6. baseline.
GenevestigatoriQ3U4H6.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ3U4H6.
SMRiQ3U4H6. Positions 50-415.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 20 family.Curated

Phylogenomic databases

eggNOGiNOG72156.
GeneTreeiENSGT00390000014852.
HOGENOMiHOG000047740.
HOVERGENiHBG061201.
InParanoidiQ3U4H6.
KOiK14459.
OMAiRTAMEDI.
TreeFamiTF314313.

Family and domain databases

Gene3Di3.20.20.80. 1 hit.
InterProiIPR015883. Glyco_hydro_20_cat-core.
IPR013781. Glyco_hydro_catalytic_dom.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PfamiPF00728. Glyco_hydro_20. 1 hit.
[Graphical view]
SUPFAMiSSF51445. SSF51445. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3U4H6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSPTPFKMR LVHLDLKGAP PKVSYLSEVF PLFHALGANG LLIEYEDMFP
60 70 80 90 100
YEGHLRLLRA KHAYSPSEVT EILRLARLSE LEVIPLVQTF GHMEFVLKHA
110 120 130 140 150
AFAHLREVAL FPNTLNPHEA ESLALVQAMI DQILELHRDV RWLHIGCDEV
160 170 180 190 200
YYLGEGETSK QWLQQEQNSH AKLCLSHMQA VASHVLTQHP GVTPLVWDDM
210 220 230 240 250
LRDIPQEQLK ASGVPQLVEP VLWDYGADLD VHGKVFLIGK YQECGFQRLW
260 270 280 290 300
AASAFKGATG ASQALPPVEH HIRNHELWLQ VAGSGPKDAL QGIILTGWQR
310 320 330 340 350
YDHFSVLCEL LPVGIPSLAA CLQSLVHGGF AEDVRLRAER FLGVSSLEIA
360 370 380 390 400
DTVSEGAGSF PGSDIHALVT QISLHLRSSV DTLLERNRYV TGWFSPYHRR
410 420 430 440 450
RKLVHPVMIQ HIQPEALSLL SRWNNLVQQL EVALQPVFYP DTIEEWLEEN
460 470 480
VLPSLQRLQD LLQDLGEAAA RQPPPTSPGW DTGQNP
Length:486
Mass (Da):54,576
Last modified:October 10, 2005 - v1
Checksum:i8F8EFEB55BB0350F
GO
Isoform 2 (identifier: Q3U4H6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG

Note: No experimental confirmation available.

Show »
Length:559
Mass (Da):62,221
Checksum:i22DE3999197B42BE
GO

Sequence cautioni

The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei328 – 3281G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2. 2 PublicationsVSP_030778

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FM204885 mRNA. Translation: CAR57923.1.
FM204886 mRNA. Translation: CAR57924.1.
AK154237 mRNA. Translation: BAE32455.1.
AL808021 Genomic DNA. Translation: CAM21737.1.
BC069960 mRNA. Translation: AAH69960.1. Different initiation.
CCDSiCCDS49013.1. [Q3U4H6-1]
RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
XP_006533327.1. XM_006533264.2. [Q3U4H6-2]
XP_006533328.1. XM_006533265.2. [Q3U4H6-2]
XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
XP_006533331.1. XM_006533268.2. [Q3U4H6-2]
XP_006533332.1. XM_006533269.2. [Q3U4H6-2]
UniGeneiMm.275130.

Genome annotation databases

EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
GeneIDi238023.
KEGGimmu:238023.
UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
uc007mvm.2. mouse. [Q3U4H6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FM204885 mRNA. Translation: CAR57923.1.
FM204886 mRNA. Translation: CAR57924.1.
AK154237 mRNA. Translation: BAE32455.1.
AL808021 Genomic DNA. Translation: CAM21737.1.
BC069960 mRNA. Translation: AAH69960.1. Different initiation.
CCDSiCCDS49013.1. [Q3U4H6-1]
RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
XP_006533327.1. XM_006533264.2. [Q3U4H6-2]
XP_006533328.1. XM_006533265.2. [Q3U4H6-2]
XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
XP_006533331.1. XM_006533268.2. [Q3U4H6-2]
XP_006533332.1. XM_006533269.2. [Q3U4H6-2]
UniGeneiMm.275130.

3D structure databases

ProteinModelPortaliQ3U4H6.
SMRiQ3U4H6. Positions 50-415.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

CAZyiGH20. Glycoside Hydrolase Family 20.

Proteomic databases

MaxQBiQ3U4H6.
PRIDEiQ3U4H6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
GeneIDi238023.
KEGGimmu:238023.
UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
uc007mvm.2. mouse. [Q3U4H6-2]

Organism-specific databases

CTDi284004.
MGIiMGI:3605542. Hexdc.

Phylogenomic databases

eggNOGiNOG72156.
GeneTreeiENSGT00390000014852.
HOGENOMiHOG000047740.
HOVERGENiHBG061201.
InParanoidiQ3U4H6.
KOiK14459.
OMAiRTAMEDI.
TreeFamiTF314313.

Enzyme and pathway databases

BRENDAi3.2.1.52. 3474.
SABIO-RKQ3U4H6.

Miscellaneous databases

NextBioi383640.
PROiQ3U4H6.
SOURCEiSearch...

Gene expression databases

BgeeiQ3U4H6.
ExpressionAtlasiQ3U4H6. baseline.
GenevestigatoriQ3U4H6.

Family and domain databases

Gene3Di3.20.20.80. 1 hit.
InterProiIPR015883. Glyco_hydro_20_cat-core.
IPR013781. Glyco_hydro_catalytic_dom.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PfamiPF00728. Glyco_hydro_20. 1 hit.
[Graphical view]
SUPFAMiSSF51445. SSF51445. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Mammalian cells contain a second nucleocytoplasmic hexosaminidase."
    Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B.
    Biochem. J. 419:83-90(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Liver.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: NOD.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2).
    Strain: FVB/N-3.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiHEXDC_MOUSE
AccessioniPrimary (citable) accession number: Q3U4H6
Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 4, 2008
Last sequence update: October 10, 2005
Last modified: March 31, 2015
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.