Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3U4H6

- HEXDC_MOUSE

UniProt

Q3U4H6 - HEXDC_MOUSE

Protein

Hexosaminidase D

Gene

Hexdc

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 76 (01 Oct 2014)
      Sequence version 1 (11 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has hexosaminidase activity.1 Publication

    Catalytic activityi

    Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.1 Publication

    Enzyme regulationi

    Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc).1 Publication

    Kineticsi

    1. KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide1 Publication

    pH dependencei

    Optimum pH is 5.5.1 Publication

    Temperature dependencei

    Optimum temperature is 37 degrees Celsius.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei149 – 1491Proton donorBy similarity

    GO - Molecular functioni

    1. beta-N-acetylhexosaminidase activity Source: UniProtKB-EC

    GO - Biological processi

    1. carbohydrate metabolic process Source: InterPro

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Enzyme and pathway databases

    SABIO-RKQ3U4H6.

    Protein family/group databases

    CAZyiGH20. Glycoside Hydrolase Family 20.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Hexosaminidase D (EC:3.2.1.52)
    Alternative name(s):
    Beta-N-acetylhexosaminidase
    Beta-hexosaminidase D
    Hexosaminidase domain-containing protein
    N-acetyl-beta-galactosaminidase
    Gene namesi
    Name:Hexdc
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:3605542. Hexdc.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 486486Hexosaminidase DPRO_0000316791Add
    BLAST

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PRIDEiQ3U4H6.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    ArrayExpressiQ3U4H6.
    BgeeiQ3U4H6.
    GenevestigatoriQ3U4H6.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ3U4H6.
    SMRiQ3U4H6. Positions 50-415.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 20 family.Curated

    Phylogenomic databases

    eggNOGiNOG72156.
    GeneTreeiENSGT00390000014852.
    HOGENOMiHOG000047740.
    HOVERGENiHBG061201.
    InParanoidiQ3U4H6.
    KOiK14459.
    OMAiVENIYID.
    TreeFamiTF314313.

    Family and domain databases

    Gene3Di3.20.20.80. 1 hit.
    InterProiIPR015883. Glyco_hydro_20_cat-core.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view]
    PfamiPF00728. Glyco_hydro_20. 1 hit.
    [Graphical view]
    SUPFAMiSSF51445. SSF51445. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q3U4H6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSPTPFKMR LVHLDLKGAP PKVSYLSEVF PLFHALGANG LLIEYEDMFP    50
    YEGHLRLLRA KHAYSPSEVT EILRLARLSE LEVIPLVQTF GHMEFVLKHA 100
    AFAHLREVAL FPNTLNPHEA ESLALVQAMI DQILELHRDV RWLHIGCDEV 150
    YYLGEGETSK QWLQQEQNSH AKLCLSHMQA VASHVLTQHP GVTPLVWDDM 200
    LRDIPQEQLK ASGVPQLVEP VLWDYGADLD VHGKVFLIGK YQECGFQRLW 250
    AASAFKGATG ASQALPPVEH HIRNHELWLQ VAGSGPKDAL QGIILTGWQR 300
    YDHFSVLCEL LPVGIPSLAA CLQSLVHGGF AEDVRLRAER FLGVSSLEIA 350
    DTVSEGAGSF PGSDIHALVT QISLHLRSSV DTLLERNRYV TGWFSPYHRR 400
    RKLVHPVMIQ HIQPEALSLL SRWNNLVQQL EVALQPVFYP DTIEEWLEEN 450
    VLPSLQRLQD LLQDLGEAAA RQPPPTSPGW DTGQNP 486
    Length:486
    Mass (Da):54,576
    Last modified:October 11, 2005 - v1
    Checksum:i8F8EFEB55BB0350F
    GO
    Isoform 2 (identifier: Q3U4H6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG

    Note: No experimental confirmation available.

    Show »
    Length:559
    Mass (Da):62,221
    Checksum:i22DE3999197B42BE
    GO

    Sequence cautioni

    The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei328 – 3281G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2. 2 PublicationsVSP_030778

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FM204885 mRNA. Translation: CAR57923.1.
    FM204886 mRNA. Translation: CAR57924.1.
    AK154237 mRNA. Translation: BAE32455.1.
    AL808021 Genomic DNA. Translation: CAM21737.1.
    BC069960 mRNA. Translation: AAH69960.1. Different initiation.
    CCDSiCCDS49013.1. [Q3U4H6-1]
    RefSeqiNP_001001333.2. NM_001001333.2. [Q3U4H6-1]
    NP_001139545.1. NM_001146073.1. [Q3U4H6-2]
    XP_006533327.1. XM_006533264.1. [Q3U4H6-2]
    XP_006533328.1. XM_006533265.1. [Q3U4H6-2]
    XP_006533329.1. XM_006533266.1. [Q3U4H6-2]
    XP_006533330.1. XM_006533267.1. [Q3U4H6-2]
    XP_006533331.1. XM_006533268.1. [Q3U4H6-2]
    XP_006533332.1. XM_006533269.1. [Q3U4H6-2]
    UniGeneiMm.275130.

    Genome annotation databases

    EnsembliENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
    ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
    GeneIDi238023.
    KEGGimmu:238023.
    UCSCiuc007mvl.2. mouse. [Q3U4H6-1]
    uc007mvm.2. mouse. [Q3U4H6-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FM204885 mRNA. Translation: CAR57923.1 .
    FM204886 mRNA. Translation: CAR57924.1 .
    AK154237 mRNA. Translation: BAE32455.1 .
    AL808021 Genomic DNA. Translation: CAM21737.1 .
    BC069960 mRNA. Translation: AAH69960.1 . Different initiation.
    CCDSi CCDS49013.1. [Q3U4H6-1 ]
    RefSeqi NP_001001333.2. NM_001001333.2. [Q3U4H6-1 ]
    NP_001139545.1. NM_001146073.1. [Q3U4H6-2 ]
    XP_006533327.1. XM_006533264.1. [Q3U4H6-2 ]
    XP_006533328.1. XM_006533265.1. [Q3U4H6-2 ]
    XP_006533329.1. XM_006533266.1. [Q3U4H6-2 ]
    XP_006533330.1. XM_006533267.1. [Q3U4H6-2 ]
    XP_006533331.1. XM_006533268.1. [Q3U4H6-2 ]
    XP_006533332.1. XM_006533269.1. [Q3U4H6-2 ]
    UniGenei Mm.275130.

    3D structure databases

    ProteinModelPortali Q3U4H6.
    SMRi Q3U4H6. Positions 50-415.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    CAZyi GH20. Glycoside Hydrolase Family 20.

    Proteomic databases

    PRIDEi Q3U4H6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000038831 ; ENSMUSP00000048479 ; ENSMUSG00000039307 . [Q3U4H6-2 ]
    ENSMUST00000106117 ; ENSMUSP00000101723 ; ENSMUSG00000039307 . [Q3U4H6-1 ]
    GeneIDi 238023.
    KEGGi mmu:238023.
    UCSCi uc007mvl.2. mouse. [Q3U4H6-1 ]
    uc007mvm.2. mouse. [Q3U4H6-2 ]

    Organism-specific databases

    CTDi 284004.
    MGIi MGI:3605542. Hexdc.

    Phylogenomic databases

    eggNOGi NOG72156.
    GeneTreei ENSGT00390000014852.
    HOGENOMi HOG000047740.
    HOVERGENi HBG061201.
    InParanoidi Q3U4H6.
    KOi K14459.
    OMAi VENIYID.
    TreeFami TF314313.

    Enzyme and pathway databases

    SABIO-RK Q3U4H6.

    Miscellaneous databases

    NextBioi 383640.
    PROi Q3U4H6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q3U4H6.
    Bgeei Q3U4H6.
    Genevestigatori Q3U4H6.

    Family and domain databases

    Gene3Di 3.20.20.80. 1 hit.
    InterProi IPR015883. Glyco_hydro_20_cat-core.
    IPR013781. Glyco_hydro_catalytic_dom.
    IPR017853. Glycoside_hydrolase_SF.
    [Graphical view ]
    Pfami PF00728. Glyco_hydro_20. 1 hit.
    [Graphical view ]
    SUPFAMi SSF51445. SSF51445. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Mammalian cells contain a second nucleocytoplasmic hexosaminidase."
      Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B.
      Biochem. J. 419:83-90(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Liver.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: NOD.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2).
      Strain: FVB/N-3.
      Tissue: Mammary tumor.

    Entry informationi

    Entry nameiHEXDC_MOUSE
    AccessioniPrimary (citable) accession number: Q3U4H6
    Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: October 11, 2005
    Last modified: October 1, 2014
    This is version 76 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3