Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q3U4H6 (HEXDC_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Hexosaminidase D

EC=3.2.1.52
Alternative name(s):
Beta-N-acetylhexosaminidase
Beta-hexosaminidase D
Hexosaminidase domain-containing protein
N-acetyl-beta-galactosaminidase
Gene names
Name:Hexdc
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length486 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has hexosaminidase activity. Ref.1

Catalytic activity

Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. Ref.1

Enzyme regulation

Inhibited by O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino N-phenylcarbamate (PUGNAc). Ref.1

Subunit structure

Homodimer; disulfide-linked. Ref.1

Subcellular location

Cytoplasm. Nucleus Ref.1.

Tissue specificity

Ubiquitous. Ref.1

Sequence similarities

Belongs to the glycosyl hydrolase 20 family.

Biophysicochemical properties

Kinetic parameters:

KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide Ref.1

pH dependence:

Optimum pH is 5.5.

Temperature dependence:

Optimum temperature is 37 degrees Celsius.

Sequence caution

The sequence AAH69960.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
   Molecular functionGlycosidase
Hydrolase
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcarbohydrate metabolic process

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionbeta-N-acetylhexosaminidase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q3U4H6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q3U4H6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: G → GALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 486486Hexosaminidase D
PRO_0000316791

Sites

Active site1491Proton donor By similarity

Natural variations

Alternative sequence3281G → GALDYSASEPGHLYMDCVVR PGAPADCAATTFHMFTGKQP PGLAGAPQDAVPFAHSTQRS GVLSEHFCLWTVSG in isoform 2.
VSP_030778

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 11, 2005. Version 1.
Checksum: 8F8EFEB55BB0350F

FASTA48654,576
        10         20         30         40         50         60 
MSSPTPFKMR LVHLDLKGAP PKVSYLSEVF PLFHALGANG LLIEYEDMFP YEGHLRLLRA 

        70         80         90        100        110        120 
KHAYSPSEVT EILRLARLSE LEVIPLVQTF GHMEFVLKHA AFAHLREVAL FPNTLNPHEA 

       130        140        150        160        170        180 
ESLALVQAMI DQILELHRDV RWLHIGCDEV YYLGEGETSK QWLQQEQNSH AKLCLSHMQA 

       190        200        210        220        230        240 
VASHVLTQHP GVTPLVWDDM LRDIPQEQLK ASGVPQLVEP VLWDYGADLD VHGKVFLIGK 

       250        260        270        280        290        300 
YQECGFQRLW AASAFKGATG ASQALPPVEH HIRNHELWLQ VAGSGPKDAL QGIILTGWQR 

       310        320        330        340        350        360 
YDHFSVLCEL LPVGIPSLAA CLQSLVHGGF AEDVRLRAER FLGVSSLEIA DTVSEGAGSF 

       370        380        390        400        410        420 
PGSDIHALVT QISLHLRSSV DTLLERNRYV TGWFSPYHRR RKLVHPVMIQ HIQPEALSLL 

       430        440        450        460        470        480 
SRWNNLVQQL EVALQPVFYP DTIEEWLEEN VLPSLQRLQD LLQDLGEAAA RQPPPTSPGW 


DTGQNP 

« Hide

Isoform 2 [UniParc].

Checksum: 22DE3999197B42BE
Show »

FASTA55962,221

References

« Hide 'large scale' references
[1]"Mammalian cells contain a second nucleocytoplasmic hexosaminidase."
Gutternigg M., Rendic D., Voglauer R., Iskratsch T., Wilson I.B.
Biochem. J. 419:83-90(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Liver.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: NOD.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-486 (ISOFORM 2).
Strain: FVB/N-3.
Tissue: Mammary tumor.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
FM204885 mRNA. Translation: CAR57923.1.
FM204886 mRNA. Translation: CAR57924.1.
AK154237 mRNA. Translation: BAE32455.1.
AL808021 Genomic DNA. Translation: CAM21737.1.
BC069960 mRNA. Translation: AAH69960.1. Different initiation.
RefSeqNP_001001333.2. NM_001001333.2.
NP_001139545.1. NM_001146073.1.
XP_006533327.1. XM_006533264.1.
XP_006533328.1. XM_006533265.1.
XP_006533329.1. XM_006533266.1.
XP_006533330.1. XM_006533267.1.
XP_006533331.1. XM_006533268.1.
XP_006533332.1. XM_006533269.1.
UniGeneMm.275130.

3D structure databases

ProteinModelPortalQ3U4H6.
SMRQ3U4H6. Positions 50-415.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

CAZyGH20. Glycoside Hydrolase Family 20.

Proteomic databases

PRIDEQ3U4H6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000038831; ENSMUSP00000048479; ENSMUSG00000039307. [Q3U4H6-2]
ENSMUST00000106117; ENSMUSP00000101723; ENSMUSG00000039307. [Q3U4H6-1]
GeneID238023.
KEGGmmu:238023.
UCSCuc007mvl.2. mouse. [Q3U4H6-1]
uc007mvm.2. mouse. [Q3U4H6-2]

Organism-specific databases

CTD284004.
MGIMGI:3605542. Hexdc.

Phylogenomic databases

eggNOGNOG72156.
GeneTreeENSGT00390000014852.
HOGENOMHOG000047740.
HOVERGENHBG061201.
InParanoidQ3U4H6.
KOK14459.
OMALTHIHIG.
TreeFamTF314313.

Enzyme and pathway databases

SABIO-RKQ3U4H6.

Gene expression databases

ArrayExpressQ3U4H6.
BgeeQ3U4H6.
GenevestigatorQ3U4H6.

Family and domain databases

Gene3D3.20.20.80. 1 hit.
InterProIPR015883. Glyco_hydro_20_cat-core.
IPR013781. Glyco_hydro_catalytic_dom.
IPR017853. Glycoside_hydrolase_SF.
[Graphical view]
PfamPF00728. Glyco_hydro_20. 1 hit.
[Graphical view]
SUPFAMSSF51445. SSF51445. 1 hit.
ProtoNetSearch...

Other

NextBio383640.
PROQ3U4H6.
SOURCESearch...

Entry information

Entry nameHEXDC_MOUSE
AccessionPrimary (citable) accession number: Q3U4H6
Secondary accession number(s): B7UUP4, B7UUP5, Q6NSQ8
Entry history
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 11, 2005
Last modified: March 19, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Glycosyl hydrolases

Classification of glycosyl hydrolase families and list of entries