Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 710

Gene

Znf710

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 710
Gene namesi
Name:Znf710
Synonyms:Zfp710
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1921747. Zfp710.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002337091 – 666Zinc finger protein 710Add BLAST666

Proteomic databases

PaxDbiQ3U288.
PeptideAtlasiQ3U288.
PRIDEiQ3U288.

PTM databases

PhosphoSitePlusiQ3U288.

Expressioni

Gene expression databases

BgeeiENSMUSG00000048897.
CleanExiMM_ZFP710.
ExpressionAtlasiQ3U288. baseline and differential.
GenevisibleiQ3U288. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000050577.

Structurei

3D structure databases

ProteinModelPortaliQ3U288.
SMRiQ3U288.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi115 – 121Poly-Glu7
Compositional biasi176 – 233Pro-richAdd BLAST58

Sequence similaritiesi

Contains 11 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00750000117653.
HOVERGENiHBG066266.
InParanoidiQ3U288.
OMAiASGGCEA.
OrthoDBiEOG091G02N1.
PhylomeDBiQ3U288.
TreeFamiTF331510.

Family and domain databases

Gene3Di3.30.160.60. 11 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3U288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGFMDSGTQ TDAVVVLSLA QAAVLGLVSE NELFGATISA EAFYPDLGPE
60 70 80 90 100
LTGTAMGEPG PPGPDIYQLA CNGRALEEPP EEEVLEVEAA FEKHTRRKTR
110 120 130 140 150
PPVRLVPKVK FEKAEEEEEQ EVYEVSVPGD DKDPGPAEAP AEVASSGCEA
160 170 180 190 200
LVQSSAVKMI DLSAFSRKPR TLRHLPRTPR PELDMAPFDP PFPDPARDGF
210 220 230 240 250
PEPSMALPGP ETLPTECSFE PPHLAPLSNP EPPNMTSTTE LVKPEQGFVW
260 270 280 290 300
QESSEFEADT AGSTVERHKK AQLDRLDINV QIDDSYLVEA GDRQKRWQCR
310 320 330 340 350
MCEKSYTSKY NLVTHILGHN GIKPHSCPHC SKLFKQPSHL QTHLLTHQGT
360 370 380 390 400
RPHKCQVCHK AFTQTSHLKR HMLLHSEVKP YSCHFCGRGF AYPSELKAHE
410 420 430 440 450
VKHESGRCHV CVECGLDFST LTQLKRHLAS HQGPTLYQCL ECDKSFHYRS
460 470 480 490 500
QLQNHMLKHQ NVRPFVCTEC GMEFSQIHHL KQHSLTHKGV KEFKCEVCGR
510 520 530 540 550
EFTLQANMKR HMLIHTSVRP YQCHICFKTF VQKQTLKTHM IVHSPVKPFK
560 570 580 590 600
CKVCGKSFNR MYNLLGHMHL HAGSKPFKCP YCSSKFNLKG NLSRHMKVKH
610 620 630 640 650
GVMDISLDSQ DPMMELAGPD PSELDNHQEM EDFEENAYTY SSVDSSAEAS
660
TLTEQAMKEM AYYNVL
Length:666
Mass (Da):75,052
Last modified:October 11, 2005 - v1
Checksum:i726110C48EAD2054
GO
Isoform 2 (identifier: Q3U288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GGWAVRSGQS...EGEPGEPLWQ

Note: No experimental confirmation available.
Show »
Length:665
Mass (Da):74,620
Checksum:iE45CD9E0C856BE1F
GO
Isoform 3 (identifier: Q3U288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GMLSTAARAAGCSYASSSSTQSAILCGVQGQPETP

Note: No experimental confirmation available.
Show »
Length:645
Mass (Da):72,114
Checksum:i116AA3F154046C61
GO

Sequence cautioni

The sequence AAH58640 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH60641 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC40892 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5M → L in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti259D → E in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti409H → R in BAC39083 (PubMed:16141072).Curated1
Sequence conflicti620D → G in BAE32948 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018152611 – 666DPMME…YYNVL → GGWAVRSGQSRIDSSMAHSG VSSPIRGVGGLAKAETSMRW AQVWREGEPGEPLWQ in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_026943611 – 666DPMME…YYNVL → GMLSTAARAAGCSYASSSST QSAILCGVQGQPETP in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036711 mRNA. Translation: BAC29546.1.
AK083979 mRNA. Translation: BAC39083.1.
AK089457 mRNA. Translation: BAC40892.1. Different initiation.
AK154871 mRNA. Translation: BAE32892.1.
AK154953 mRNA. Translation: BAE32948.1.
AK155416 mRNA. Translation: BAE33254.1.
BC058640 mRNA. Translation: AAH58640.3. Different initiation.
BC060641 mRNA. Translation: AAH60641.1. Different initiation.
CCDSiCCDS52279.1. [Q3U288-3]
CCDS52280.1. [Q3U288-1]
RefSeqiNP_001139471.1. NM_001145999.1. [Q3U288-1]
NP_001139472.1. NM_001146000.1. [Q3U288-3]
NP_780642.3. NM_175433.5. [Q3U288-1]
XP_006540805.1. XM_006540742.3. [Q3U288-1]
XP_006540806.1. XM_006540743.3. [Q3U288-1]
XP_006540807.1. XM_006540744.3. [Q3U288-1]
UniGeneiMm.290925.

Genome annotation databases

EnsembliENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897. [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897. [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897. [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897. [Q3U288-2]
GeneIDi209225.
KEGGimmu:209225.
UCSCiuc009hzi.2. mouse. [Q3U288-3]
uc009hzj.2. mouse. [Q3U288-1]
uc009hzk.2. mouse. [Q3U288-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036711 mRNA. Translation: BAC29546.1.
AK083979 mRNA. Translation: BAC39083.1.
AK089457 mRNA. Translation: BAC40892.1. Different initiation.
AK154871 mRNA. Translation: BAE32892.1.
AK154953 mRNA. Translation: BAE32948.1.
AK155416 mRNA. Translation: BAE33254.1.
BC058640 mRNA. Translation: AAH58640.3. Different initiation.
BC060641 mRNA. Translation: AAH60641.1. Different initiation.
CCDSiCCDS52279.1. [Q3U288-3]
CCDS52280.1. [Q3U288-1]
RefSeqiNP_001139471.1. NM_001145999.1. [Q3U288-1]
NP_001139472.1. NM_001146000.1. [Q3U288-3]
NP_780642.3. NM_175433.5. [Q3U288-1]
XP_006540805.1. XM_006540742.3. [Q3U288-1]
XP_006540806.1. XM_006540743.3. [Q3U288-1]
XP_006540807.1. XM_006540744.3. [Q3U288-1]
UniGeneiMm.290925.

3D structure databases

ProteinModelPortaliQ3U288.
SMRiQ3U288.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000050577.

PTM databases

PhosphoSitePlusiQ3U288.

Proteomic databases

PaxDbiQ3U288.
PeptideAtlasiQ3U288.
PRIDEiQ3U288.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897. [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897. [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897. [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897. [Q3U288-2]
GeneIDi209225.
KEGGimmu:209225.
UCSCiuc009hzi.2. mouse. [Q3U288-3]
uc009hzj.2. mouse. [Q3U288-1]
uc009hzk.2. mouse. [Q3U288-2]

Organism-specific databases

CTDi209225.
MGIiMGI:1921747. Zfp710.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00750000117653.
HOVERGENiHBG066266.
InParanoidiQ3U288.
OMAiASGGCEA.
OrthoDBiEOG091G02N1.
PhylomeDBiQ3U288.
TreeFamiTF331510.

Miscellaneous databases

PROiQ3U288.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000048897.
CleanExiMM_ZFP710.
ExpressionAtlasiQ3U288. baseline and differential.
GenevisibleiQ3U288. MM.

Family and domain databases

Gene3Di3.30.160.60. 11 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN710_MOUSE
AccessioniPrimary (citable) accession number: Q3U288
Secondary accession number(s): Q3U341
, Q3U396, Q6P9R3, Q8BJH0, Q8BTL6, Q8BZ48
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: October 11, 2005
Last modified: November 30, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.