Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AT-rich interactive domain-containing protein 5A

Gene

Arid5a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

DNA-binding protein that may regulate transcription and act as a repressor by binding to AT-rich stretches in the promoter region of target genes.By similarity

GO - Molecular functioni

  • chromatin binding Source: MGI
  • DNA binding Source: UniProtKB-KW
  • transcription factor binding Source: MGI

GO - Biological processi

  • chondrocyte differentiation Source: MGI
  • positive regulation of histone acetylation Source: MGI
  • positive regulation of transcription from RNA polymerase II promoter Source: MGI
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
AT-rich interactive domain-containing protein 5A
Short name:
ARID domain-containing protein 5A
Gene namesi
Name:Arid5a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:2443039. Arid5a.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  • nucleolus Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: MGI
  • transcription factor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 590590AT-rich interactive domain-containing protein 5APRO_0000288931Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei24 – 241PhosphoserineCombined sources
Modified residuei283 – 2831PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ3U108.
PaxDbiQ3U108.
PRIDEiQ3U108.

PTM databases

iPTMnetiQ3U108.
PhosphoSiteiQ3U108.

Expressioni

Gene expression databases

BgeeiQ3U108.
CleanExiMM_ARID5A.
ExpressionAtlasiQ3U108. baseline and differential.
GenevisibleiQ3U108. MM.

Interactioni

GO - Molecular functioni

  • transcription factor binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110684.

Structurei

3D structure databases

ProteinModelPortaliQ3U108.
SMRiQ3U108. Positions 50-156.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 14293ARIDPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 ARID domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IQ79. Eukaryota.
ENOG4111RDB. LUCA.
GeneTreeiENSGT00840000129864.
HOVERGENiHBG062210.
InParanoidiQ3U108.
OMAiGLMHFPP.
TreeFamiTF324725.

Family and domain databases

Gene3Di1.10.150.60. 1 hit.
InterProiIPR001606. ARID_dom.
[Graphical view]
PfamiPF01388. ARID. 1 hit.
[Graphical view]
SMARTiSM00501. BRIGHT. 1 hit.
[Graphical view]
SUPFAMiSSF46774. SSF46774. 1 hit.
PROSITEiPS51011. ARID. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3U108-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPPAKGNT EQSEEGDLPQ LPVSPKPDDE QSRSQSPTQL QDSPEAGGEQ
60 70 80 90 100
EEEQAFLVSL YKFMKERHTP IERVPHLGFK QINLWKIYKA VEKLGAYELV
110 120 130 140 150
TGRRLWKNVY DELGGSPGST SAATCTRRHY ERLVLPYVRH LKGEDDKPLP
160 170 180 190 200
PTKPRKQYKM AKELRGDDGT TEKLKKAKDS EERRVEQTTP GKTKSDATGQ
210 220 230 240 250
TQLPCQGSSR DSTEQLGPVS GPSPPLTGAS SCPEAYKRLL SSFYCKGAHG
260 270 280 290 300
IMSPLAKKKL LAQVSKAEAL QCQEEGCRHG ARSPNKDIQD SPQNLRGPAE
310 320 330 340 350
NSEHQLTPRE GLQAPGGSTR MEAQVGPCPT APMFSGCFHA YPTEVLKPVS
360 370 380 390 400
QHPRDFFSGL KDRVLLGPPG KEEGPTTKES HLVWGGDANH PSAFHKGSTR
410 420 430 440 450
KRSFYPKPKA CWVSPMAKVP TERPGAPSPH PSSPGLGSKR GLEEEGFAHG
460 470 480 490 500
GKKLRAVSPF LKEVDSKETG GKPAAPGLAV SCLLGPTPGP TPPEAYRGTM
510 520 530 540 550
LRCPLNFTGS ADPLKGQASL PFSPLVIPAF PAHLLATTGS SPMAASLMHF
560 570 580 590
PPTPYDAVLR NRLGPASSAW HMPPVTTYAA PHFFHLNTKL
Length:590
Mass (Da):63,898
Last modified:October 11, 2005 - v1
Checksum:iD4C00C2F1DEBDCC3
GO
Isoform 2 (identifier: Q3U108-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MA → MLKGGRPDLCVVNSLIKLQKLKLHVDAEHQT

Show »
Length:619
Mass (Da):67,163
Checksum:i45AF3962604B372A
GO
Isoform 3 (identifier: Q3U108-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-2: Missing.
     81-82: QI → QSASLGGGGW...DRLPCLFPSV

Show »
Length:684
Mass (Da):73,323
Checksum:i9156EB0980CD3F35
GO
Isoform 4 (identifier: Q3U108-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-99: Missing.

Show »
Length:532
Mass (Da):57,124
Checksum:iEC8556C8C58565C9
GO
Isoform 5 (identifier: Q3U108-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.

Show »
Length:431
Mass (Da):45,846
Checksum:i62191DF092B2A60E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti51 – 511E → K in BAE34133 (PubMed:16141072).Curated
Sequence conflicti94 – 941L → Q in BAE29358 (PubMed:16141072).Curated
Sequence conflicti540 – 5401S → P in AAH27152 (PubMed:15489334).Curated
Sequence conflicti585 – 5851H → R in BAE29115 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 5. 2 PublicationsVSP_025838Add
BLAST
Alternative sequencei1 – 22MA → MLKGGRPDLCVVNSLIKLQK LKLHVDAEHQT in isoform 2. 1 PublicationVSP_025839
Alternative sequencei2 – 21Missing in isoform 3. 1 PublicationVSP_025840
Alternative sequencei42 – 9958Missing in isoform 4. 1 PublicationVSP_025841Add
BLAST
Alternative sequencei81 – 822QI → QSASLGGGGWCSGRVSVGGQ QPGDVPRQDNRQGTSAKGDP GCRQPVGVACEDGASLKARG GVGFSSSWAACPVHNSGPAW ECGVTEPDRLPCLFPSV in isoform 3. 1 PublicationVSP_025842

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041344 mRNA. Translation: BAC30913.1.
AK085015 mRNA. Translation: BAC39338.1.
AK149839 mRNA. Translation: BAE29115.1.
AK150170 mRNA. Translation: BAE29358.1.
AK156376 mRNA. Translation: BAE33692.1.
AK156622 mRNA. Translation: BAE33779.1.
AK156934 mRNA. Translation: BAE33904.1.
AK157607 mRNA. Translation: BAE34133.1.
BC027152 mRNA. Translation: AAH27152.1.
CCDSiCCDS14876.1. [Q3U108-4]
CCDS48239.1. [Q3U108-1]
CCDS69878.1. [Q3U108-5]
CCDS78560.1. [Q3U108-2]
RefSeqiNP_001165676.1. NM_001172205.1. [Q3U108-1]
NP_001165677.1. NM_001172206.1.
NP_001277655.1. NM_001290726.1.
NP_001277656.1. NM_001290727.1. [Q3U108-5]
NP_666108.2. NM_145996.4. [Q3U108-4]
XP_006495912.1. XM_006495849.2. [Q3U108-3]
UniGeneiMm.297482.
Mm.34316.

Genome annotation databases

EnsembliENSMUST00000115029; ENSMUSP00000110681; ENSMUSG00000037447. [Q3U108-5]
ENSMUST00000115031; ENSMUSP00000110683; ENSMUSG00000037447. [Q3U108-3]
ENSMUST00000115032; ENSMUSP00000110684; ENSMUSG00000037447. [Q3U108-1]
ENSMUST00000137906; ENSMUSP00000117810; ENSMUSG00000037447. [Q3U108-4]
GeneIDi214855.
KEGGimmu:214855.
UCSCiuc007apu.2. mouse. [Q3U108-4]
uc007apv.2. mouse. [Q3U108-1]
uc007apy.2. mouse. [Q3U108-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041344 mRNA. Translation: BAC30913.1.
AK085015 mRNA. Translation: BAC39338.1.
AK149839 mRNA. Translation: BAE29115.1.
AK150170 mRNA. Translation: BAE29358.1.
AK156376 mRNA. Translation: BAE33692.1.
AK156622 mRNA. Translation: BAE33779.1.
AK156934 mRNA. Translation: BAE33904.1.
AK157607 mRNA. Translation: BAE34133.1.
BC027152 mRNA. Translation: AAH27152.1.
CCDSiCCDS14876.1. [Q3U108-4]
CCDS48239.1. [Q3U108-1]
CCDS69878.1. [Q3U108-5]
CCDS78560.1. [Q3U108-2]
RefSeqiNP_001165676.1. NM_001172205.1. [Q3U108-1]
NP_001165677.1. NM_001172206.1.
NP_001277655.1. NM_001290726.1.
NP_001277656.1. NM_001290727.1. [Q3U108-5]
NP_666108.2. NM_145996.4. [Q3U108-4]
XP_006495912.1. XM_006495849.2. [Q3U108-3]
UniGeneiMm.297482.
Mm.34316.

3D structure databases

ProteinModelPortaliQ3U108.
SMRiQ3U108. Positions 50-156.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110684.

PTM databases

iPTMnetiQ3U108.
PhosphoSiteiQ3U108.

Proteomic databases

EPDiQ3U108.
PaxDbiQ3U108.
PRIDEiQ3U108.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000115029; ENSMUSP00000110681; ENSMUSG00000037447. [Q3U108-5]
ENSMUST00000115031; ENSMUSP00000110683; ENSMUSG00000037447. [Q3U108-3]
ENSMUST00000115032; ENSMUSP00000110684; ENSMUSG00000037447. [Q3U108-1]
ENSMUST00000137906; ENSMUSP00000117810; ENSMUSG00000037447. [Q3U108-4]
GeneIDi214855.
KEGGimmu:214855.
UCSCiuc007apu.2. mouse. [Q3U108-4]
uc007apv.2. mouse. [Q3U108-1]
uc007apy.2. mouse. [Q3U108-3]

Organism-specific databases

CTDi10865.
MGIiMGI:2443039. Arid5a.

Phylogenomic databases

eggNOGiENOG410IQ79. Eukaryota.
ENOG4111RDB. LUCA.
GeneTreeiENSGT00840000129864.
HOVERGENiHBG062210.
InParanoidiQ3U108.
OMAiGLMHFPP.
TreeFamiTF324725.

Miscellaneous databases

PROiQ3U108.
SOURCEiSearch...

Gene expression databases

BgeeiQ3U108.
CleanExiMM_ARID5A.
ExpressionAtlasiQ3U108. baseline and differential.
GenevisibleiQ3U108. MM.

Family and domain databases

Gene3Di1.10.150.60. 1 hit.
InterProiIPR001606. ARID_dom.
[Graphical view]
PfamiPF01388. ARID. 1 hit.
[Graphical view]
SMARTiSM00501. BRIGHT. 1 hit.
[Graphical view]
SUPFAMiSSF46774. SSF46774. 1 hit.
PROSITEiPS51011. ARID. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow, Embryonic lung, Spleen and Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  3. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24 AND SER-283, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Lung and Spleen.

Entry informationi

Entry nameiARI5A_MOUSE
AccessioniPrimary (citable) accession number: Q3U108
Secondary accession number(s): Q3TZS4
, Q3U0F0, Q3U0S2, Q3UDA3, Q3UDZ6, Q8BI45, Q8BYB5, Q8R2W1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 11, 2005
Last modified: June 8, 2016
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.