Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q3TRM4 (PLPL6_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 76. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neuropathy target esterase

EC=3.1.1.5
Alternative name(s):
Patatin-like phospholipase domain-containing protein 6
Gene names
Name:Pnpla6
Synonyms:Nte
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1355 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy. Ref.5 Ref.6

Catalytic activity

2-lysophosphatidylcholine + H2O = glycerophosphocholine + a carboxylate.

Enzyme regulation

Inhibited by a series a OPs such as mipafox (MPX), phenyl saligenin phosphate (PSP), phenyl dipentyl phosphinate (PDPP), diisopropyl fluorophosphate and paraoxon. Ref.6

Subcellular location

Endoplasmic reticulum membrane; Single-pass type I membrane protein; Cytoplasmic side. Note: Anchored to the cytoplasmic face of the endoplasmic reticulum by its amino-terminal transmembrane segment. Ref.6

Tissue specificity

Expressed ubiquitously in brain of young mice. Reaching adulthood, there is a most prominent expression in Purkinje cells, granule cells and pyramidal neurons of the hippocampus and some large neurons in the medulla oblongata, nucleus dentatus and pons. Ref.1

Developmental stage

Expressed in the embryonic respiratory system, different epithelial structures and strongly in the spinal ganglia, during the development. Ref.1

Post-translational modification

Glycosylated By similarity.

Sequence similarities

Belongs to the NTE family.

Contains 3 cyclic nucleotide-binding domains.

Contains 1 patatin domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q3TRM4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q3TRM4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGTPSHELNTTSSGAEVIQKTLEEGLGRRICVAQPVPFVPQ → MEAPLQTGM
Note: No experimental confirmation available.
Isoform 3 (identifier: Q3TRM4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGTPSHELNTTSSGAEVIQKTLEEGLGRRICVAQPVPFVPQ → MEAPLQTGM
     448-448: R → RTPTQ
Note: No experimental confirmation available.
Isoform 4 (identifier: Q3TRM4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1123-1169: ADIARSMGAK...LWKRLNPWAD → GKWLPTHICM...RGHTQLCTEL
     1170-1355: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 13551355Neuropathy target esterase
PRO_0000292200

Regions

Topological domain1 – 4343Lumenal Potential
Transmembrane44 – 6421Helical; Potential
Topological domain65 – 13551291Cytoplasmic Potential
Domain961 – 1127167Patatin
Nucleotide binding179 – 306128cNMP 1
Nucleotide binding492 – 614123cNMP 2
Nucleotide binding610 – 730121cNMP 3
Motif992 – 9965GXSXG

Sites

Active site9941 By similarity

Amino acid modifications

Modified residue3381Phosphoserine By similarity
Modified residue3451Phosphothreonine By similarity
Modified residue3461Phosphoserine By similarity
Glycosylation91N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 4141MGTPS…PFVPQ → MEAPLQTGM in isoform 2 and isoform 3.
VSP_026390
Alternative sequence4481R → RTPTQ in isoform 3.
VSP_026391
Alternative sequence1123 – 116947ADIAR…NPWAD → GKWLPTHICMDTYHQTHAHT DFCTCRLEGTGLYEWRSSRG HTQLCTEL in isoform 4.
VSP_026392
Alternative sequence1170 – 1355186Missing in isoform 4.
VSP_026393

Experimental info

Sequence conflict2401E → K in AAD51700. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 26, 2007. Version 2.
Checksum: 813263C6A82083ED

FASTA1,355149,537
        10         20         30         40         50         60 
MGTPSHELNT TSSGAEVIQK TLEEGLGRRI CVAQPVPFVP QVLGVMIGAG VAVLVTAVLI 

        70         80         90        100        110        120 
LLVVRRLRVQ KTPAPEGPRY RFRKRDKVLF YGRKIMRKVS QSTSSLVDTS VSTTSRPRMK 

       130        140        150        160        170        180 
KKLKMLNIAK KILRIQKETP TLQRKEPPPS VLEADLTEGD LANSHLPSEV LYMLKNVRVL 

       190        200        210        220        230        240 
GHFEKPLFLE LCRHMVFQRL GQGDYVFRPG QPDASIYVVQ DGLLELCLPG PDGKECVVKE 

       250        260        270        280        290        300 
VVPGDSVNSL LSILDVITGH QHPQRTVSAR AARDSTVLRL PVEAFSAVFT KYPESLVRVV 

       310        320        330        340        350        360 
QIIMVRLQRV TFLALHNYLG LTNELFSHEI QPLRLFPSPG LPTRTSPVRG SKRVVSTSGT 

       370        380        390        400        410        420 
EDTSKETSGR PLDSIGAPLP GPAGDPVKPT SLEAPPAPLL SRCISMPVDI SGLQGGPRSD 

       430        440        450        460        470        480 
FDMAYERGRI SVSLQEEASG GPQTASPREL REQPAGACEY SYCEDESATG GCPFGPYQGR 

       490        500        510        520        530        540 
QTSSIFEAAK RELAKLMRIE DPSLLNSRVL LHHAKAGTII ARQGDQDVSL HFVLWGCLHV 

       550        560        570        580        590        600 
YQRMIDKAEE VCLFVAQPGE LVGQLAVLTG EPLIFTLRAQ RDCTFLRISK SHFYEIMRAQ 

       610        620        630        640        650        660 
PSVVLSAAHT VAARMSPFVR QMDFAIDWTA VEAGRALYRQ GDRSDCTYIV LNGRLRSVIQ 

       670        680        690        700        710        720 
RGSGKKELVG EYGRGDLIGV VEALTRQPRA TTVHAVRDTE LAKLPEGTLG HIKRRYPQVV 

       730        740        750        760        770        780 
TRLIHLLSQK ILGNLQQLQG PFPGSGLSVP QHSELTNPAS NLSTVAILPV CAEVPMMAFT 

       790        800        810        820        830        840 
LELQHALQAI GPTLLLNSDV IRALLGASAL DSIQEFRLSG WLAQQEDAHR IVLYQTDTSL 

       850        860        870        880        890        900 
TPWTVRCLRQ ADCILIVGLG DQEPTVGQLE QMLENTAVRA LKQLVLLHRE EGPGPTRTVE 

       910        920        930        940        950        960 
WLNMRSWCSG HLHLRCPRRL FSRRSPAKLH ELYEKVFSRR ADRHSDFSRL ARVLTGNTIA 

       970        980        990       1000       1010       1020 
LVLGGGGARG CSHIGVLKAL EEAGVPVDLV GGTSIGSFIG ALYAEERSAS RTKQRAREWA 

      1030       1040       1050       1060       1070       1080 
KSMTSVLEPV LDLTYPVTSM FTGSAFNRSI HRVFQDKQIE DLWLPYFNVT TDITASAMRV 

      1090       1100       1110       1120       1130       1140 
HKDGSLWRYV RASMTLSGYL PPLCDPKDGH LLMDGGYINN LPADIARSMG AKTVIAIDVG 

      1150       1160       1170       1180       1190       1200 
SQDETDLSTY GDSLSGWWLL WKRLNPWADK VKVPDMAEIQ SRLAYVSCVR QLEVVKSSSY 

      1210       1220       1230       1240       1250       1260 
CEYLRPSIDC FKTMDFGKFD QIYDVGYQYG KAVFGGWTRG EVIEKMLTDR RSTDLNESRR 

      1270       1280       1290       1300       1310       1320 
ADILAFPSSG FTDLAEIVSR IEPPTSYVSD GCADGEESDC LTEYEEDAGP DCSRDEGGSP 

      1330       1340       1350 
EGASPSTASE VEEEKSTLRQ RRFLPQETPS SVADA 

« Hide

Isoform 2 [UniParc].

Checksum: B27BC1F45801A2A4
Show »

FASTA1,323146,136
Isoform 3 [UniParc].

Checksum: 61DC2256B2C9C4F8
Show »

FASTA1,327146,563
Isoform 4 [UniParc].

Checksum: 34CC6F6A8FEE4B6D
Show »

FASTA1,170129,347

References

« Hide 'large scale' references
[1]"Cloning and expression of the murine sws/NTE gene."
Moser M., Stempfl T., Li Y., Glynn P., Buttner R., Kretzschmar D.
Mech. Dev. 90:279-282(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: BALB/c.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Strain: C57BL/6J.
Tissue: Bone.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Brain.
[5]"Loss of neuropathy target esterase in mice links organophosphate exposure to hyperactivity."
Winrow C.J., Hemming M.L., Allen D.M., Quistad G.B., Casida J.E., Barlow C.
Nat. Genet. 33:477-485(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[6]"Phospholipase B activity and organophosphorus compound toxicity in cultured neural cells."
Read D.J., Langford L., Barbour H.R., Forshaw P.J., Glynn P.
Toxicol. Appl. Pharmacol. 219:190-195(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF173829 mRNA. Translation: AAD51700.1.
AK162641 mRNA. Translation: BAE37004.1.
AC170806 Genomic DNA. No translation available.
BC054789 mRNA. Translation: AAH54789.1.
BC056999 mRNA. Translation: AAH56999.1.
RefSeqNP_001116290.2. NM_001122818.2.
NP_056616.2. NM_015801.2.
XP_006508887.1. XM_006508824.1.
XP_006508896.1. XM_006508833.1.
UniGeneMm.23085.

3D structure databases

ProteinModelPortalQ3TRM4.
SMRQ3TRM4. Positions 173-311, 505-714.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ3TRM4.

Proteomic databases

PaxDbQ3TRM4.
PRIDEQ3TRM4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000004681; ENSMUSP00000004681; ENSMUSG00000004565. [Q3TRM4-3]
ENSMUST00000111070; ENSMUSP00000106699; ENSMUSG00000004565. [Q3TRM4-3]
GeneID50767.
KEGGmmu:50767.
UCSCuc009krr.1. mouse. [Q3TRM4-3]
uc009krs.1. mouse. [Q3TRM4-2]
uc009krt.1. mouse. [Q3TRM4-4]
uc009kru.1. mouse. [Q3TRM4-1]

Organism-specific databases

CTD10908.
MGIMGI:1354723. Pnpla6.

Phylogenomic databases

eggNOGCOG0664.
GeneTreeENSGT00390000002533.
HOGENOMHOG000016081.
HOVERGENHBG053067.
InParanoidQ3TRM4.
KOK14676.
OMAKQRAREW.
OrthoDBEOG7QRQT1.
PhylomeDBQ3TRM4.
TreeFamTF300519.

Gene expression databases

BgeeQ3TRM4.
CleanExMM_PNPLA6.
GenevestigatorQ3TRM4.

Family and domain databases

Gene3D2.60.120.10. 3 hits.
InterProIPR016035. Acyl_Trfase/lysoPLipase.
IPR018490. cNMP-bd-like.
IPR000595. cNMP-bd_dom.
IPR001423. LysoPLipase_patatin_CS.
IPR002641. Patatin/PLipase_A2-rel.
IPR014710. RmlC-like_jellyroll.
[Graphical view]
PfamPF00027. cNMP_binding. 3 hits.
PF01734. Patatin. 1 hit.
[Graphical view]
SMARTSM00100. cNMP. 3 hits.
[Graphical view]
SUPFAMSSF51206. SSF51206. 3 hits.
SSF52151. SSF52151. 1 hit.
PROSITEPS50042. CNMP_BINDING_3. 3 hits.
PS01237. UPF0028. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio307675.
PROQ3TRM4.
SOURCESearch...

Entry information

Entry namePLPL6_MOUSE
AccessionPrimary (citable) accession number: Q3TRM4
Secondary accession number(s): Q7TQD6, Q9R114
Entry history
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: April 16, 2014
This is version 76 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot