Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Midnolin

Gene

Midn

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in regulation of genes related to neurogenesis in the nucleolus.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Midnolin
Alternative name(s):
Midbrain nucleolar protein
Gene namesi
Name:Midn
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1890222. Midn.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: MGI
  • nucleolus Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 465465MidnolinPRO_0000287537Add
BLAST

Proteomic databases

MaxQBiQ3TPJ7.
PeptideAtlasiQ3TPJ7.
PRIDEiQ3TPJ7.

PTM databases

PhosphoSiteiQ3TPJ7.

Expressioni

Developmental stagei

Strongly expressed at the mesencephalon (midbrain) of the embryo in day 12.5 (E12.5).1 Publication

Gene expression databases

BgeeiENSMUSG00000035621.
CleanExiMM_MIDN.
ExpressionAtlasiQ3TPJ7. baseline and differential.
GenevisibleiQ3TPJ7. MM.

Interactioni

GO - Molecular functioni

Structurei

3D structure databases

ProteinModelPortaliQ3TPJ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini32 – 10675Ubiquitin-likePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni397 – 42428Required for nucleolar localizationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi184 – 25471Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 ubiquitin-like domain.PROSITE-ProRule annotation

Phylogenomic databases

GeneTreeiENSGT00510000049027.
HOGENOMiHOG000072693.
HOVERGENiHBG098000.
InParanoidiQ3TPJ7.
OMAiRMCKPPG.
OrthoDBiEOG091G0X8V.
PhylomeDBiQ3TPJ7.
TreeFamiTF329735.

Family and domain databases

InterProiIPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PfamiPF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00213. UBQ. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiPS50053. UBIQUITIN_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3TPJ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPQPGGARS CRRGAPGGAC ELNTATESAA PMSLAIHSTT GTRYDLSVPH
60 70 80 90 100
DETVEGLRKR LSQRLKVPKE RLALLHKDTR LSSGKLQEFG VGDGSKLTLV
110 120 130 140 150
PTVEAGLMSQ ASRPEQSVMQ ALESLTETQV SDFLSGRSPL TLALRVGDHM
160 170 180 190 200
MFVQLQLAAQ HAPLQHRHVL AAAAAAAAAA RGDSSVATPV SSPCRPVSSA
210 220 230 240 250
ARVPPVSSSP SSPVSPSPVT AGSFRSHAAS TTCPEQMDCS PPASSSSTST
260 270 280 290 300
PGSSPTPRSR KPGAVIESFV NHAPGVFSGT FSGTLHPNCQ DSSGRPRRDI
310 320 330 340 350
GTILQILNDL LSATRHYQGM PPSLTQLRCH AQCSPASPAP DLTPKTTSCE
360 370 380 390 400
KLAATSSTSL LQGQSQIRMC KPPGDRLRQT ENRATRCKVE RLQLLLQQKR
410 420 430 440 450
LRRKARRDAR GPYHWTPSRK AGRSDSSSSG GGGGPSEATG LGLDFEDSVW
460
KPEVNPDIQS EFVVA
Length:465
Mass (Da):49,192
Last modified:October 11, 2005 - v1
Checksum:iF32E5C4D95DEAAD8
GO
Isoform 2 (identifier: Q3TPJ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-128: T → TQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERP

Show »
Length:508
Mass (Da):53,940
Checksum:i6373DFFABA6194A3
GO
Isoform 3 (identifier: Q3TPJ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-128: T → TQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERP
     236-236: Missing.

Show »
Length:507
Mass (Da):53,812
Checksum:iB13180C412617E64
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei128 – 1281T → TQPPATPGPGRAAGGGFRKY RLILFKRPWHRQGPQSPERG GERP in isoform 2 and isoform 3. 3 PublicationsVSP_025552
Alternative sequencei236 – 2361Missing in isoform 3. 1 PublicationVSP_025553

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB036882 mRNA. Translation: BAB00638.1.
AK154535 mRNA. Translation: BAE32660.1.
AK164324 mRNA. Translation: BAE37739.1.
BC034719 mRNA. Translation: AAH34719.1.
CCDSiCCDS24011.1. [Q3TPJ7-2]
RefSeqiNP_001292727.1. NM_001305798.1.
NP_001292728.1. NM_001305799.1. [Q3TPJ7-3]
NP_067540.1. NM_021565.2. [Q3TPJ7-2]
XP_006513976.1. XM_006513913.2. [Q3TPJ7-2]
XP_006513977.1. XM_006513914.1. [Q3TPJ7-1]
UniGeneiMm.143813.

Genome annotation databases

EnsembliENSMUST00000042057; ENSMUSP00000046967; ENSMUSG00000035621. [Q3TPJ7-2]
ENSMUST00000099492; ENSMUSP00000097091; ENSMUSG00000035621. [Q3TPJ7-1]
GeneIDi59090.
KEGGimmu:59090.
UCSCiuc007gca.2. mouse. [Q3TPJ7-2]
uc007gcb.2. mouse. [Q3TPJ7-1]
uc007gcc.2. mouse. [Q3TPJ7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB036882 mRNA. Translation: BAB00638.1.
AK154535 mRNA. Translation: BAE32660.1.
AK164324 mRNA. Translation: BAE37739.1.
BC034719 mRNA. Translation: AAH34719.1.
CCDSiCCDS24011.1. [Q3TPJ7-2]
RefSeqiNP_001292727.1. NM_001305798.1.
NP_001292728.1. NM_001305799.1. [Q3TPJ7-3]
NP_067540.1. NM_021565.2. [Q3TPJ7-2]
XP_006513976.1. XM_006513913.2. [Q3TPJ7-2]
XP_006513977.1. XM_006513914.1. [Q3TPJ7-1]
UniGeneiMm.143813.

3D structure databases

ProteinModelPortaliQ3TPJ7.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ3TPJ7.

Proteomic databases

MaxQBiQ3TPJ7.
PeptideAtlasiQ3TPJ7.
PRIDEiQ3TPJ7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042057; ENSMUSP00000046967; ENSMUSG00000035621. [Q3TPJ7-2]
ENSMUST00000099492; ENSMUSP00000097091; ENSMUSG00000035621. [Q3TPJ7-1]
GeneIDi59090.
KEGGimmu:59090.
UCSCiuc007gca.2. mouse. [Q3TPJ7-2]
uc007gcb.2. mouse. [Q3TPJ7-1]
uc007gcc.2. mouse. [Q3TPJ7-3]

Organism-specific databases

CTDi90007.
MGIiMGI:1890222. Midn.

Phylogenomic databases

GeneTreeiENSGT00510000049027.
HOGENOMiHOG000072693.
HOVERGENiHBG098000.
InParanoidiQ3TPJ7.
OMAiRMCKPPG.
OrthoDBiEOG091G0X8V.
PhylomeDBiQ3TPJ7.
TreeFamiTF329735.

Miscellaneous databases

PROiQ3TPJ7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000035621.
CleanExiMM_MIDN.
ExpressionAtlasiQ3TPJ7. baseline and differential.
GenevisibleiQ3TPJ7. MM.

Family and domain databases

InterProiIPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PfamiPF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00213. UBQ. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiPS50053. UBIQUITIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMIDN_MOUSE
AccessioniPrimary (citable) accession number: Q3TPJ7
Secondary accession number(s): Q3U3X5, Q9JJJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: October 11, 2005
Last modified: September 7, 2016
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.