Q3TJD7 (PDLI7_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 59.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PDZ and LIM domain protein 7 Alternative name(s): LIM mineralization protein Short name=LMP Protein enigma | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 457 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation e.g (embryonic flat bones mandible and cranium), and endochondral bone formation e.g (embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway By similarity. |
| Subunit structure | Specifically binds via its LIM zinc-binding 3 domain (LIM 3) domain to endocytic codes of INSR, but not with those of IGF1R, LDLR, TFRC, or EGFR. Interacts with various PKC isoforms through the LIM zinc-binding domains. Binds to RET in a phosphorylation-independent manner via its LIM zinc-binding domain 2 (LIM 2). Probably part of a complex with SHC and the RET dimer. Interacts with TPM2, TBX4 and TBX5 By similarity. |
| Subcellular location | Cytoplasm By similarity. Cytoplasm › cytoskeleton By similarity. Note: Colocalizes with RET to the cell periphery and in some cytoskeletal components. Colocalizes with TPM2 near the Z line in muscle. Co-localizes with TBX4 and TBX5 to actin filaments By similarity. |
| Developmental stage | At E13.5 expressed in epaxial, intercostal, and other skeletal muscles at the brachial level, including the latissimus dorsi muscle. Expressed in the intrinsic and extrinsic muscle mass of the tongue. At E15 expressed in mesenchymal tissue surrounding the cartilaginous anlage of immature bones, and in the future joint spaces. As endochondral ossification progresses, and the hypertrophic cartilage zone is replaced by mineralized bone, expression appears in the mineralizing portion of the bone. Expressed in mesoderm derived bones of the skull base and neural crest-derived endochondral bones such as the proximal mandible. Ref.3 Ref.4 |
| Domain | The LIM zinc-binding 2 domain (LIM 2) interacts with TBX4 By similarity. The LIM zinc-binding 3 domain (LIM 3) provides the structural basis for recognition of tyrosine-containing tight turn structures. This domain is necessary and sufficient for interaction with TBX5 By similarity. Anchored to cell periphery via its N-terminal PDZ domain By similarity. |
| Sequence similarities | Contains 3 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Osteogenesis |
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | actin cytoskeleton organization Inferred from physical interaction. Source: MGI cell differentiationInferred from electronic annotation. Source: UniProtKB-KW multicellular organismal developmentInferred from electronic annotation. Source: UniProtKB-KW ossificationInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from direct assay. Source: MGI ruffleInferred from direct assay. Source: MGI stress fiberInferred from direct assay. Source: MGI |
| Molecular function | protein binding Inferred from physical interaction. Source: MGI zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3TJD7-1) Also known as: LMP-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3TJD7-2) The sequence of this isoform differs from the canonical sequence as follows: 94-133: ALTPPADPPRYTFAPSASLNKTARPFGAPPPTDSTLRQNG → VQTSDK 191-222: SQVPRTEAPAPASTIPQESWPGPTTPSPTSRP → REKYVLELQSPRYTRLRDWHHQRSAHVLNVQS 223-457: Missing. | ||||||
| Isoform 3 (identifier: Q3TJD7-3) The sequence of this isoform differs from the canonical sequence as follows: 134-153: QLLRQPVPDASKQRLMEDTE → CRPLTNSCSDSRSPMPASSG 154-457: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 457 | 457 | PDZ and LIM domain protein 7 | PRO_0000075882 | |||||
Regions | |||||||||
| Domain | 1 – 85 | 85 | PDZ | ||||||
| Domain | 280 – 338 | 59 | LIM zinc-binding 1 | ||||||
| Domain | 339 – 398 | 60 | LIM zinc-binding 2 | ||||||
| Domain | 399 – 457 | 59 | LIM zinc-binding 3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 247 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 251 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 94 – 133 | 40 | ALTPP…LRQNG → VQTSDK in isoform 2. | VSP_016517 | |||||
| Alternative sequence | 134 – 153 | 20 | QLLRQ…MEDTE → CRPLTNSCSDSRSPMPASSG in isoform 3. | VSP_016518 | |||||
| Alternative sequence | 154 – 457 | 304 | Missing in isoform 3. | VSP_016519 | |||||
| Alternative sequence | 191 – 222 | 32 | SQVPR…PTSRP → REKYVLELQSPRYTRLRDWH HQRSAHVLNVQS in isoform 2. | VSP_016520 | |||||
| Alternative sequence | 223 – 457 | 235 | Missing in isoform 2. | VSP_016521 | |||||
Experimental info | |||||||||
| Sequence conflict | 85 | 1 | Q → P in BAB22725. Ref.1 | ||||||
| Sequence conflict | 151 | 1 | D → G in AAH49565. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 305-457 (ISOFORM 1). Strain: FVB/N. Tissue: Brain and Colon. |
| [3] | "LMP-1, a LIM-domain protein, mediates BMP-6 effects on bone formation." Boden S.D., Liu Y., Hair G.A., Helms J.A., Hu D., Racine M., Nanes M.S., Titus L. Endocrinology 139:5125-5134(1998) [PubMed: 9832452] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [4] | "The PDZ domain of the LIM protein enigma binds to beta-tropomyosin." Guy P.M., Kenny D.A., Gill G.N. Mol. Biol. Cell 10:1973-1984(1999) [PubMed: 10359609] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK003338 mRNA. Translation: BAB22725.1. AK010141 mRNA. Translation: BAB26726.1. AK003019 mRNA. Translation: BAC25017.1. AK167476 mRNA. Translation: BAE39558.1. BC045528 mRNA. Translation: AAH45528.1. BC049565 mRNA. Translation: AAH49565.1. |
| IPI | IPI00130607. IPI00315878. IPI00404528. |
| RefSeq | NP_001107559.1. NM_001114087.1. NP_001107560.1. NM_001114088.1. NP_080407.3. NM_026131.3. |
| UniGene | Mm.275648. |
3D structure databases | |
| ProteinModelPortal | Q3TJD7. |
| SMR | Q3TJD7. Positions 1-84, 274-455. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q3TJD7. |
PTM databases | |
| PhosphoSite | Q3TJD7. |
Proteomic databases | |
| PRIDE | Q3TJD7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000046246; ENSMUSP00000047173; ENSMUSG00000021493. ENSMUST00000069929; ENSMUSP00000064219; ENSMUSG00000021493. ENSMUST00000109909; ENSMUSP00000105535; ENSMUSG00000021493. ENSMUST00000155098; ENSMUSP00000120465; ENSMUSG00000021493. |
| GeneID | 67399. |
| KEGG | mmu:67399. |
Organism-specific databases | |
| CTD | 9260. |
| MGI | MGI:1914649. Pdlim7. |
Phylogenomic databases | |
| eggNOG | roNOG16727. |
| GeneTree | ENSGT00600000084390. |
| HOGENOM | HBG505271. |
| HOVERGEN | HBG051478. |
| InParanoid | Q3TJD7. |
| OMA | RPLCKSH. |
Gene expression databases | |
| ArrayExpress | Q3TJD7. |
| Bgee | Q3TJD7. |
| CleanEx | MM_PDLIM7. |
| Genevestigator | Q3TJD7. |
| GermOnline | ENSMUSG00000021493. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001478. PDZ/DHR/GLGF. IPR001781. Znf_LIM. [Graphical view] |
| Gene3D | G3DSA:2.10.110.10. Znf_LIM. 3 hits. |
| Pfam | PF00412. LIM. 3 hits. PF00595. PDZ. 1 hit. [Graphical view] |
| SMART | SM00132. LIM. 3 hits. SM00228. PDZ. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 1 hit. |
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 3 hits. PS50106. PDZ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 324470. |
| SOURCE | Search... |
Entry information
| Entry name | PDLI7_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3TJD7 Secondary accession number(s): Q80ZY6 Q9CRA1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with