Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin protein zero-like protein 1

Gene

Mpzl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 2 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2, may be involved in regulation of integrin-mediated cell motility (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin protein zero-like protein 1
Alternative name(s):
Protein zero-related
Gene namesi
Name:Mpzl1
Synonyms:Pzr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1915731. Mpzl1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini36 – 162127ExtracellularSequence analysisAdd
BLAST
Transmembranei163 – 18321HelicalSequence analysisAdd
BLAST
Topological domaini184 – 27087CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence analysisAdd
BLAST
Chaini36 – 270235Myelin protein zero-like protein 1PRO_0000240336Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi50 – 501N-linked (GlcNAc...)Sequence analysis
Disulfide bondi58 ↔ 135PROSITE-ProRule annotation
Glycosylationi130 – 1301N-linked (GlcNAc...)1 Publication
Modified residuei204 – 2041PhosphoserineBy similarity
Modified residuei206 – 2061PhosphoserineBy similarity
Modified residuei210 – 2101PhosphoserineBy similarity
Modified residuei221 – 2211PhosphoserineBy similarity
Modified residuei242 – 2421PhosphotyrosineBy similarity
Modified residuei261 – 2611PhosphoserineBy similarity
Modified residuei264 – 2641PhosphotyrosineBy similarity

Post-translational modificationi

Phosphorylated on tyrosine residues upon stimulation with pervanadate and concanavalin-A (ConA). Phosphorylation at Tyr-242 and Tyr-264 is required for interaction with PTPN11/SHP-2. Dephosphorylated by PTPN11/SHP-2 (in vitro) (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ3TEW6.
PaxDbiQ3TEW6.
PeptideAtlasiQ3TEW6.
PRIDEiQ3TEW6.

PTM databases

iPTMnetiQ3TEW6.
PhosphoSiteiQ3TEW6.

Expressioni

Gene expression databases

BgeeiQ3TEW6.
CleanExiMM_MPZL1.
ExpressionAtlasiQ3TEW6. baseline and differential.
GenevisibleiQ3TEW6. MM.

Interactioni

Subunit structurei

Interacts with phosphorylated PTPN11/SHP-2.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000107062.

Structurei

3D structure databases

ProteinModelPortaliQ3TEW6.
SMRiQ3TEW6. Positions 40-156.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 151116Ig-like V-typeAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi240 – 2456ITIM motif 1
Motifi262 – 2676ITIM motif 2

Domaini

Sequence similaritiesi

Belongs to the myelin P0 protein family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVXC. Eukaryota.
ENOG4111MDZ. LUCA.
GeneTreeiENSGT00640000091161.
HOGENOMiHOG000232144.
HOVERGENiHBG104511.
InParanoidiQ3TEW6.
KOiK06770.
OMAiHQGPVIY.
OrthoDBiEOG7G1V80.
PhylomeDBiQ3TEW6.
TreeFamiTF331728.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR029870. MPZL1.
IPR000920. Myelin_P0-rel.
[Graphical view]
PANTHERiPTHR13869. PTHR13869. 1 hit.
PTHR13869:SF19. PTHR13869:SF19. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3TEW6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEAVGAVAL IAAPARRRWL WSVLAAMLGL LTARISALEV HTPKEIFVVN
60 70 80 90 100
GTQGKLTCTF DSPNTTGWLT TVSWSFQPDG TDSAVSFFHY SQGQVYIGDY
110 120 130 140 150
PPFKDRVTWA GDLDKKDASI NIENIQAVHN GTYICDVKNP PDIVVRPGHI
160 170 180 190 200
RLHVVEIDNL LVFLVWVVVG TVTAVVLGLT LLISLVLVVL YRRKHSKRDY
210 220 230 240 250
TGCSTSERLS PVKQAPRKCP SDTEGLVKSP PSAGSHQGPV IYAQLDHSGG
260 270
HHSGKINKSE SVVYADIRKD
Length:270
Mass (Da):29,495
Last modified:October 11, 2005 - v1
Checksum:i1E033F0F5F732C22
GO
Isoform 2 (identifier: Q3TEW6-2) [UniParc]FASTAAdd to basket

Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     203-270: CSTSERLSPVKQAPRKCPSDTEGLVKSPPSAGSHQGPVIYAQLDHSGGHHSGKINKSESVVYADIRKD → AQSFT

Show »
Length:207
Mass (Da):22,820
Checksum:i390F451D11FDBE02
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti202 – 2021G → GFIS in AAX11678 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei203 – 27068CSTSE…DIRKD → AQSFT in isoform 2. 2 PublicationsVSP_019345Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK169385 mRNA. Translation: BAE41132.1.
AY764247 mRNA. Translation: AAX11678.1.
AY764248 mRNA. Translation: AAX11679.1.
BC072563 mRNA. Translation: AAH72563.1.
CCDSiCCDS35757.1. [Q3TEW6-1]
RefSeqiNP_001001880.1. NM_001001880.2.
NP_001077366.1. NM_001083897.1. [Q3TEW6-1]
UniGeneiMm.46438.

Genome annotation databases

EnsembliENSMUST00000111435; ENSMUSP00000107062; ENSMUSG00000026566. [Q3TEW6-1]
GeneIDi68481.
KEGGimmu:68481.
UCSCiuc007djh.1. mouse. [Q3TEW6-1]
uc007dji.1. mouse. [Q3TEW6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK169385 mRNA. Translation: BAE41132.1.
AY764247 mRNA. Translation: AAX11678.1.
AY764248 mRNA. Translation: AAX11679.1.
BC072563 mRNA. Translation: AAH72563.1.
CCDSiCCDS35757.1. [Q3TEW6-1]
RefSeqiNP_001001880.1. NM_001001880.2.
NP_001077366.1. NM_001083897.1. [Q3TEW6-1]
UniGeneiMm.46438.

3D structure databases

ProteinModelPortaliQ3TEW6.
SMRiQ3TEW6. Positions 40-156.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000107062.

PTM databases

iPTMnetiQ3TEW6.
PhosphoSiteiQ3TEW6.

Proteomic databases

MaxQBiQ3TEW6.
PaxDbiQ3TEW6.
PeptideAtlasiQ3TEW6.
PRIDEiQ3TEW6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000111435; ENSMUSP00000107062; ENSMUSG00000026566. [Q3TEW6-1]
GeneIDi68481.
KEGGimmu:68481.
UCSCiuc007djh.1. mouse. [Q3TEW6-1]
uc007dji.1. mouse. [Q3TEW6-2]

Organism-specific databases

CTDi9019.
MGIiMGI:1915731. Mpzl1.

Phylogenomic databases

eggNOGiENOG410IVXC. Eukaryota.
ENOG4111MDZ. LUCA.
GeneTreeiENSGT00640000091161.
HOGENOMiHOG000232144.
HOVERGENiHBG104511.
InParanoidiQ3TEW6.
KOiK06770.
OMAiHQGPVIY.
OrthoDBiEOG7G1V80.
PhylomeDBiQ3TEW6.
TreeFamiTF331728.

Miscellaneous databases

ChiTaRSiMpzl1. mouse.
PROiQ3TEW6.
SOURCEiSearch...

Gene expression databases

BgeeiQ3TEW6.
CleanExiMM_MPZL1.
ExpressionAtlasiQ3TEW6. baseline and differential.
GenevisibleiQ3TEW6. MM.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR029870. MPZL1.
IPR000920. Myelin_P0-rel.
[Graphical view]
PANTHERiPTHR13869. PTHR13869. 1 hit.
PTHR13869:SF19. PTHR13869:SF19. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Stomach.
  2. "The murine ortholog of the SHP-2 binding molecule, PZR, is expressed during mesodermal commitment and accelerates cell migration on fibronectin."
    Roubelakis M.G., Martin-Rendon E., Tsaknakis G., Watt S.M.
    Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-130.

Entry informationi

Entry nameiMPZL1_MOUSE
AccessioniPrimary (citable) accession number: Q3TEW6
Secondary accession number(s): Q2VW02, Q6GQX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: October 11, 2005
Last modified: July 6, 2016
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.