Q3TBT3 (STING_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Stimulator of interferon genes protein Short name=mSTING Alternative name(s): Endoplasmic reticulum interferon stimulator Short name=ERIS Mediator of IRF3 activation Short name=MMITA Transmembrane protein 173 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 378 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Ref.1 Ref.2 Ref.6 Ref.7 Ref.8 Ref.9 |
| Subunit structure | Homodimer; 'Lys-63'-linked ubiquitination at Lys-150 is required for homodimerization. Interacts with TBK1; when homodimer, leading to subsequent production of IFN-beta By similarity. Interacts with DDX58/RIG-I, MAVS and SSR2. Interacts with RNF5. Associates with the MHC-II complex. Interacts with IFIT1 and IFIT2 By similarity. Ref.2 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein By similarity. Cell membrane; Multi-pass membrane protein. Cytoplasm › perinuclear region. Note: In response to double-stranded DNA stimulation, relocalizes to perinuclear region, where the kinase TBK1 is recruited. Ref.2 Ref.7 |
| Tissue specificity | Present in spleen and thymus tissue. Also present in dendritic cells (at protein level). Ref.2 |
| Developmental stage | Expressed throughout the B-cell lineage prior to the plasma cell stage but occurs at highest levels in mature B-cells. Highly expressed in cells representing mature stages of B-cells but weakly expressed in pre-B cells, immature B-cells, and memory B-cell stages. Not detected in plasma cells. Ref.2 |
| Domain | The c-di-GMP-binding domain (CBD) forms a homodimer via hydrophobic interactions and binds both the cyclic diguanylate monophosphate (c-di-GMP) and the cyclic GMP-AMP (cGAMP) messengers. In absence of c-di-GMP or cGAMP, the protein is autoinhibited by an intramolecular interaction between the CBD and the C-terminal tail (CTT). Binding of c-di-GMP or cGAMP to the CBD releases the autoinhibition by displacing the CTT, leading to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon. The N-terminal part of the CBD region was initially though to contain a fifth transmembrane region (TM5) but is part of the folded, soluble CBD By similarity. |
| Post-translational modification | Phosphorylated on Ser-357 by TBK1, leading to activation and production of IFN-beta By similarity. Phosphorylated on tyrosine residues upon MHC-II aggregation. Ref.2 Ubiquitinated. 'Lys-63'-linked ubiquitination mediated by TRIM56 at Lys-150 promotes homodimerization and recruitment of the antiviral kinase TBK1 and subsequent production of IFN-beta. 'Lys-48'-linked polyubiquitination at Lys-150 occurring after viral infection is mediated by RNF5 and leads to proteasomal degradation By similarity. |
| Disruption phenotype | Defects in innate immunity. Death within 7 days of herpes simplex virus 1 (HSV-1) infection. In addition, mice show a remarkable reduction in cytotoxic T-cell responses after plasmid DNA vaccination. Cells fail to induce type I interferon production in response to dsDNA and infection with herpes simplex virus 1 (HSV-1) and L.monocytogenes that deliver DNA to the host cytosol. Ref.7 |
| Miscellaneous | Was named MPYS because the protein sequence begins by Met-Pro-Tyr-Ser residues (Ref.2). |
| Sequence similarities | Belongs to the TMEM173 family. |
| Sequence caution | The sequence AAH27757.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAC37010.1 differs from that shown. Reason: Erroneous termination at position 203. Translated as Leu. The sequence BAE42563.1 differs from that shown. Reason: Frameshift at position 377. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3TBT3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3TBT3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MIVESFGASGNPVGPCHFWSLYGVLLGVHWSVLHLGTFRGIRSAGLWLLM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q3TBT3-3) The sequence of this isoform differs from the canonical sequence as follows: 76-116: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 378 | 378 | Stimulator of interferon genes protein | PRO_0000271117 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Topological domain | 1 – 20 | 20 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||
| Transmembrane | 21 – 41 | 21 | Helical; Name=1; Potential | |||||||||||||||||||||||||||||||||||||
| Topological domain | 42 – 46 | 5 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||
| Transmembrane | 47 – 67 | 21 | Helical; Name=2; Potential | |||||||||||||||||||||||||||||||||||||
| Topological domain | 68 – 86 | 19 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||
| Transmembrane | 87 – 106 | 20 | Helical; Name=3; Potential | |||||||||||||||||||||||||||||||||||||
| Topological domain | 107 – 114 | 8 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||
| Transmembrane | 115 – 135 | 21 | Helical; Name=4; Potential | |||||||||||||||||||||||||||||||||||||
| Topological domain | 136 – 378 | 243 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||
| Region | 152 – 339 | 188 | c-di-GMP-binding domain (CBD) By similarity | |||||||||||||||||||||||||||||||||||||
| Region | 339 – 378 | 40 | C-terminal tail (CTT) By similarity | |||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||
| Binding site | 262 | 1 | c-di-GMP By similarity | |||||||||||||||||||||||||||||||||||||
| Site | 166 | 1 | Required for c-di-GMP-binding By similarity | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 357 | 1 | Phosphoserine; by TBK1 By similarity | |||||||||||||||||||||||||||||||||||||
| Cross-link | 150 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MIVESFGASGNPVGPCHFWS LYGVLLGVHWSVLHLGTFRG IRSAGLWLLM in isoform 2. | VSP_022284 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 76 – 116 | 41 | Missing in isoform 3. | VSP_022285 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 161 | 1 | S → A: Decrease in cGAMP-binding. Ref.9 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 239 | 1 | Y → S: Strong decrease in cGAMP-binding. Ref.9 | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 241 | 1 | N → A: Strong decrease in cGAMP-binding. Ref.9 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 11 | 1 | P → Q in BAE27042. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 39 | 1 | P → S in BAB27972. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 | 1 | M → V in BAE42563. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 111 | 1 | T → N in BAC37010. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 210 | 1 | N → D in BAE34068. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 210 | 1 | N → D in BAE42310. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 210 | 1 | N → D in BAE42224. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 210 | 1 | N → D in BAE32222. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 210 | 1 | N → D in BAE34517. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 315 | 1 | E → K in BAC37010. Ref.3 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Helix | 156 – 164 | 9 | ||||||||||||||||||||||||||||||||||||||
| Helix | 167 – 170 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 171 – 173 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 184 | 11 | ||||||||||||||||||||||||||||||||||||||
| Turn | 185 – 187 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 202 | 9 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 212 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 218 – 223 | 6 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 228 – 230 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 248 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 260 | 10 | ||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 270 | 8 | ||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 299 | 16 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 301 – 303 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 307 – 313 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 317 – 320 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 324 – 333 | 10 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The adaptor protein MITA links virus-sensing receptors to IRF3 transcription factor activation." Zhong B., Yang Y., Li S., Wang Y.-Y., Li Y., Diao F., Lei C., He X., Zhang L., Tien P., Shu H.-B. Immunity 29:538-550(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION. |
| [2] | "MPYS, a novel membrane tetraspanner, is associated with major histocompatibility complex class II and mediates transduction of apoptotic signals." Jin L., Waterman P.M., Jonscher K.R., Short C.M., Reisdorph N.A., Cambier J.C. Mol. Cell. Biol. 28:5014-5026(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, SUBUNIT, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, PHOSPHORYLATION. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6J. Tissue: Embryo, Inner ear, Spleen and Thymus. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Czech II and FVB/N. Tissue: Mammary gland. |
| [6] | "STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling." Ishikawa H., Barber G.N. Nature 455:674-678(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "STING regulates intracellular DNA-mediated, type I interferon-dependent innate immunity." Ishikawa H., Ma Z., Barber G.N. Nature 461:788-792(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE. |
| [8] | "ERIS, an endoplasmic reticulum IFN stimulator, activates innate immune signaling through dimerization." Sun W., Li Y., Chen L., Chen H., You F., Zhou X., Zhou Y., Zhai Z., Chen D., Jiang Z. Proc. Natl. Acad. Sci. U.S.A. 106:8653-8658(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Cyclic GMP-AMP is an endogenous second messenger in innate immune signaling by cytosolic DNA." Wu J., Sun L., Chen X., Du F., Shi H., Chen C., Chen Z.J. Science 339:826-830(2013) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CGAMP-BINDING, MUTAGENESIS OF SER-161; TYR-239 AND ASN-241. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | FJ222242 mRNA. Translation: ACI46649.1. DQ910493 mRNA. Translation: ABI78935.1. AK012006 mRNA. Translation: BAB27972.1. AK077788 mRNA. Translation: BAC37010.1. Sequence problems. AK089405 mRNA. Translation: BAC40870.1. AK146284 mRNA. Translation: BAE27042.1. AK153868 mRNA. Translation: BAE32222.1. AK157370 mRNA. Translation: BAE34068.1. AK158458 mRNA. Translation: BAE34517.1. AK170724 mRNA. Translation: BAE41981.1. AK171065 mRNA. Translation: BAE42224.1. AK171203 mRNA. Translation: BAE42310.1. AK171612 mRNA. Translation: BAE42563.1. Frameshift. CH466557 Genomic DNA. Translation: EDK97142.1. BC027757 mRNA. Translation: AAH27757.1. Different initiation. BC046640 mRNA. Translation: AAH46640.1. | ||||||||||||||||||
| IPI | IPI00651829. IPI00674006. IPI00677447. | ||||||||||||||||||
| RefSeq | NP_082537.1. NM_028261.1. | ||||||||||||||||||
| UniGene | Mm.45995. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q3TBT3. | ||||||||||||||||||
| SMR | Q3TBT3. Positions 152-342. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-59959N. | ||||||||||||||||||
| IntAct | Q3TBT3. 4 interactions. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q3TBT3. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q3TBT3. | ||||||||||||||||||
| PRIDE | Q3TBT3. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSMUST00000115728; ENSMUSP00000111393; ENSMUSG00000024349. | ||||||||||||||||||
| GeneID | 72512. | ||||||||||||||||||
| KEGG | mmu:72512. | ||||||||||||||||||
| UCSC | uc008emt.3. mouse. uc008emu.3. mouse. uc008emv.3. mouse. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 340061. | ||||||||||||||||||
| MGI | MGI:1919762. Tmem173. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG43926. | ||||||||||||||||||
| GeneTree | ENSGT00390000008582. | ||||||||||||||||||
| HOVERGEN | HBG094065. | ||||||||||||||||||
| InParanoid | A7YGY9. | ||||||||||||||||||
| KO | K12654. | ||||||||||||||||||
| OMA | LFAMSQD. | ||||||||||||||||||
| OrthoDB | EOG4PK295. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | Q3TBT3. | ||||||||||||||||||
| CleanEx | MM_TMEM173. | ||||||||||||||||||
| Genevestigator | Q3TBT3. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 336376. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | STING_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q3TBT3 Secondary accession number(s): A7YGY9 Q9CZY7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
