Q3SYG4 (PTHB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein PTHB1 Alternative name(s): Bardet-Biedl syndrome 9 protein Parathyroid hormone-responsive B1 gene protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 887 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. Ref.5 |
| Subunit structure | Part of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8, BBS9 and BBIP10. The BBSome complex binds to PCM1 and tubulin. Ref.5 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome. Cell projection › cilium membrane. Cytoplasm. Note: Localizes to nonmembranous centriolar satellites in the cytoplasm. Ref.5 |
| Tissue specificity | Widely expressed. Expressed in adult heart, skeletal muscle, lung, liver, kidney, placenta and brain, and in fetal kidney, lung, liver and brain. Ref.2 Ref.6 |
| Induction | Down-regulated by parathyroid hormone. Ref.2 |
| Involvement in disease | A chromosomal aberration involving PTHB1 has been found in Wilms tumor. Translocation t(1;7)(q42;p15) with OBSCN. Bardet-Biedl syndrome 9 (BBS9) [MIM:209900]: A syndrome characterized by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. Bardet-Biedl syndrome inheritance is autosomal recessive, but three mutated alleles (two at one locus, and a third at a second locus) may be required for clinical manifestation of some forms of the disease. |
| Sequence caution | The sequence AAD25980.1 differs from that shown. Reason: Chimera. The sequence AAD25981.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BBS1 | Q8NFJ9 | 6 | EBI-2826852,EBI-1805484 | |
| BBS10 | Q8TAM1 | 2 | EBI-2826852,EBI-6128013 | |
| BBS12 | Q6ZW61 | 2 | EBI-2826852,EBI-6128352 | |
| BBS2 | Q9BXC9 | 9 | EBI-2826852,EBI-748297 | |
| BBS5 | Q8N3I7 | 3 | EBI-2826852,EBI-2892592 | |
| LZTFL1 | Q9NQ48 | 6 | EBI-2826852,EBI-2824799 | |
| TTC8 | Q8TAM2 | 2 | EBI-2826852,EBI-2892638 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3SYG4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3SYG4-2) The sequence of this isoform differs from the canonical sequence as follows: 478-518: TPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDG → S | ||||||
| Isoform 3 (identifier: Q3SYG4-3) The sequence of this isoform differs from the canonical sequence as follows: 878-887: EVSPLQGVSE → GKRLDGLHKR | ||||||
| Isoform 4 (identifier: Q3SYG4-4) The sequence of this isoform differs from the canonical sequence as follows: 478-513: TPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTD → N | ||||||
| Isoform 5 (identifier: Q3SYG4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-45: Missing. 339-355: HDLKGVIVTLSDDGHLQ → QFSLWKHLLPRSSTLEK 356-887: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q3SYG4-6) The sequence of this isoform differs from the canonical sequence as follows: 478-481: TPDL → IFSS 482-887: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 887 | 887 | Protein PTHB1 | PRO_0000235269 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 45 | 45 | Missing in isoform 5. | VSP_018421 | |||||
| Alternative sequence | 339 – 355 | 17 | HDLKG…DGHLQ → QFSLWKHLLPRSSTLEK in isoform 5. | VSP_018422 | |||||
| Alternative sequence | 356 – 887 | 532 | Missing in isoform 5. | VSP_018423 | |||||
| Alternative sequence | 478 – 518 | 41 | TPDLT…RNPDG → S in isoform 2. | VSP_018426 | |||||
| Alternative sequence | 478 – 513 | 36 | TPDLT…SRPTD → N in isoform 4. | VSP_018427 | |||||
| Alternative sequence | 478 – 481 | 4 | TPDL → IFSS in isoform 6. | VSP_018424 | |||||
| Alternative sequence | 482 – 887 | 406 | Missing in isoform 6. | VSP_018425 | |||||
| Alternative sequence | 878 – 887 | 10 | EVSPLQGVSE → GKRLDGLHKR in isoform 3. | VSP_018428 | |||||
| Natural variant | 12 | 1 | T → A. Corresponds to variant rs4498440 [ dbSNP | Ensembl ]. | VAR_051289 | |||||
| Natural variant | 141 | 1 | G → R in BBS9. Ref.6 | VAR_026389 | |||||
| Natural variant | 455 | 1 | A → T. Corresponds to variant rs11773504 [ dbSNP | Ensembl ]. | VAR_051290 | |||||
| Natural variant | 455 | 1 | A → V. Corresponds to variant rs11773504 [ dbSNP | Ensembl ]. | VAR_026390 | |||||
| Natural variant | 521 | 1 | R → Q. Corresponds to variant rs34218557 [ dbSNP | Ensembl ]. | VAR_051291 | |||||
| Natural variant | 549 | 1 | T → I. Ref.7 Corresponds to variant rs59252892 [ dbSNP | Ensembl ]. | VAR_066292 | |||||
| Natural variant | 665 | 1 | L → F. Ref.7 Corresponds to variant rs116262072 [ dbSNP | Ensembl ]. | VAR_066293 | |||||
| Natural variant | 779 | 1 | L → Q. Ref.7 Corresponds to variant rs142434516 [ dbSNP | Ensembl ]. | VAR_066294 | |||||
Experimental info | |||||||||
| Sequence conflict | 282 | 1 | K → R in AAD25981. Ref.2 | ||||||
| Sequence conflict | 759 | 1 | L → V in AAB47568. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Uterus. |
| [2] | "Identification of a novel parathyroid hormone-responsive gene in human osteoblastic cells." Adams A.E., Rosenblatt M., Suva L.J. Bone 24:305-313(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 20-887 (ISOFORM 2), INDUCTION, TISSUE SPECIFICITY. Tissue: Osteosarcoma. |
| [3] | "Positional candidates for the RP9 retinitis pigmentosa gene." Keen T.J. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 424-887 (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 611-887 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 435-887 (ISOFORM 3), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 842-887. Tissue: Brain and Spleen. |
| [4] | "The parathyroid hormone-responsive B1 gene is interrupted by a t(1;7)(q42;p15) breakpoint associated with Wilms' tumour." Vernon E.G., Malik K., Reynolds P., Powlesland R., Dallosso A.R., Jackson S., Henthorn K., Green E.D., Brown K.W. Oncogene 22:1371-1380(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 4 AND 6), CHROMOSOMAL TRANSLOCATION WITH OBSCN. |
| [5] | "A core complex of BBS proteins cooperates with the GTPase Rab8 to promote ciliary membrane biogenesis." Nachury M.V., Loktev A.V., Zhang Q., Westlake C.J., Peraenen J., Merdes A., Slusarski D.C., Scheller R.H., Bazan J.F., Sheffield V.C., Jackson P.K. Cell 129:1201-1213(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBUNIT, FUNCTION, SUBCELLULAR LOCATION. |
| [6] | "Comparative genomics and gene expression analysis identifies BBS9, a new Bardet-Biedl syndrome gene." Nishimura D.Y., Swiderski R.E., Searby C.C., Berg E.M., Ferguson A.L., Hennekam R.C.M., Merin S., Weleber R.G., Biesecker L.G., Stone E.M., Sheffield V.C. Am. J. Hum. Genet. 77:1021-1033(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT BBS9 ARG-141, TISSUE SPECIFICITY. |
| [7] | "BBS genotype-phenotype assessment of a multiethnic patient cohort calls for a revision of the disease definition." Deveault C., Billingsley G., Duncan J.L., Bin J., Theal R., Vincent A., Fieggen K.J., Gerth C., Noordeh N., Traboulsi E.I., Fishman G.A., Chitayat D., Knueppel T., Millan J.M., Munier F.L., Kennedy D., Jacobson S.G., Innes A.M. Heon E.Hum. Mutat. 32:610-619(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ILE-549; PHE-665 AND GLN-779. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC032715 mRNA. Translation: AAH32715.1. BC103831 mRNA. Translation: AAI03832.1. AF095770 mRNA. Translation: AAD25980.1. Sequence problems. AF095771 mRNA. Translation: AAD25981.1. Different initiation. U85994 mRNA. Translation: AAB61918.1. U85995 mRNA. Translation: AAB61919.1. U85997 Genomic DNA. Translation: AAB46606.1. U87408 mRNA. Translation: AAB47568.1. |
| IPI | IPI00166804. IPI00477766. IPI00479833. IPI00651741. IPI00658164. IPI00748340. |
| RefSeq | NP_001028776.1. NM_001033604.1. NP_001028777.1. NM_001033605.1. NP_055266.2. NM_014451.3. NP_940820.1. NM_198428.2. |
| UniGene | Hs.372360. |
3D structure databases | |
| ProteinModelPortal | Q3SYG4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q3SYG4. 11 interactions. |
| MINT | MINT-3059897. |
PTM databases | |
| PhosphoSite | Q3SYG4. |
Polymorphism databases | |
| DMDM | 97180305. |
Proteomic databases | |
| PaxDb | Q3SYG4. |
| PRIDE | Q3SYG4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000242067; ENSP00000242067; ENSG00000122507. ENST00000350941; ENSP00000313122; ENSG00000122507. ENST00000396127; ENSP00000379433; ENSG00000122507. ENST00000425508; ENSP00000405151; ENSG00000122507. |
| GeneID | 27241. |
| KEGG | hsa:27241. |
| UCSC | uc003tdn.1. human. uc003tdo.1. human. uc003tdq.1. human. |
Organism-specific databases | |
| CTD | 27241. |
| GeneCards | GC07P033168. |
| HGNC | HGNC:30000. BBS9. |
| HPA | HPA021289. |
| MIM | 209900. phenotype. 607968. gene. |
| neXtProt | NX_Q3SYG4. |
| Orphanet | 110. Bardet-Biedl syndrome. |
| PharmGKB | PA162377359. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG329692. |
| HOVERGEN | HBG082225. |
| OMA | PLQEDTQ. |
| OrthoDB | EOG4Z36D1. |
Gene expression databases | |
| ArrayExpress | Q3SYG4. |
| Bgee | Q3SYG4. |
| Genevestigator | Q3SYG4. |
Family and domain databases | |
| InterPro | IPR026511. PTHB1. [Graphical view] |
| PANTHER | PTHR20991. PTHR20991. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BBS9. human. |
| GenomeRNAi | 27241. |
| NextBio | 50129. |
| SOURCE | Search... |
Entry information
| Entry name | PTHB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q3SYG4 Secondary accession number(s): P78514 Q9Y6A0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
