Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable tubulin polyglutamylase TTLL9

Gene

TTLL9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Probably acts when complexed with other proteins (By similarity).By similarity

Caution

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei224ATPBy similarity1
Binding sitei226ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi211 – 214ATP bindingBy similarity4

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionLigase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

Names & Taxonomyi

Protein namesi
Recommended name:
Probable tubulin polyglutamylase TTLL9 (EC:6.-.-.-)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 9
Gene namesi
Name:TTLL9
Synonyms:C20orf125
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000131044.16
HGNCiHGNC:16118 TTLL9
neXtProtiNX_Q3SXZ7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi164395
OpenTargetsiENSG00000131044
PharmGKBiPA25666

Polymorphism and mutation databases

BioMutaiTTLL9
DMDMi215274204

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003245171 – 439Probable tubulin polyglutamylase TTLL9Add BLAST439

Proteomic databases

MaxQBiQ3SXZ7
PaxDbiQ3SXZ7
PeptideAtlasiQ3SXZ7
PRIDEiQ3SXZ7

PTM databases

iPTMnetiQ3SXZ7
PhosphoSitePlusiQ3SXZ7

Expressioni

Gene expression databases

BgeeiENSG00000131044
CleanExiHS_TTLL9
ExpressionAtlasiQ3SXZ7 baseline and differential
GenevisibleiQ3SXZ7 HS

Organism-specific databases

HPAiHPA041772
HPA055676

Interactioni

Protein-protein interaction databases

BioGridi1278956 interactors.
STRINGi9606.ENSP00000365105

Structurei

3D structure databases

ProteinModelPortaliQ3SXZ7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 380TTLPROSITE-ProRule annotationAdd BLAST341

Phylogenomic databases

eggNOGiKOG2157 Eukaryota
ENOG410XQDM LUCA
GeneTreeiENSGT00760000118951
HOVERGENiHBG066341
InParanoidiQ3SXZ7
KOiK16603
OMAiGFARFCH
OrthoDBiEOG091G082M
PhylomeDBiQ3SXZ7
TreeFamiTF313087

Family and domain databases

Gene3Di3.30.1490.201 hit
InterProiView protein in InterPro
IPR013815 ATP_grasp_subdomain_1
IPR004344 TTL/TTLL_fam
IPR027751 TTLL9
PANTHERiPTHR12241:SF39 PTHR12241:SF39, 1 hit
PfamiView protein in Pfam
PF03133 TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221 TTL, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3SXZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVPSREALLG PGTTAIRCPK KLQNQNYKGH GLSKGKEREQ RASIRFKTTL
60 70 80 90 100
MNTLMDVLRH RPGWVEVKDE GEWDFYWCDV SWLRENFDHT YMDEHVRISH
110 120 130 140 150
FRNHYELTRK NYMVKNLKRF RKQLEREAGK LEAAKCDFFP KTFEMPCEYH
160 170 180 190 200
LFVEEFRKNP GITWIMKPVA RSQGKGIFLF RRLKDIVDWR KDTRSSDDQK
210 220 230 240 250
DDIPVENYVA QRYIENPYLI GGRKFDLRVY VLVMSVFAEC LLWSGHRRQD
260 270 280 290 300
VHLTNVAVQK TSPDYHPKKG CKWTLQRFRQ YLASKHGPEA VETLFRDIDN
310 320 330 340 350
IFVKSLQSVQ KVIISDKHCF ELYGYDILID QDLKPWLLEV NASPSLTASS
360 370 380 390 400
QEDYELKTCL LEDTLHVVDM EARLTGREKR VGGFDLMWND GPVSREEGAP
410 420 430
DLSGMGNFVT NTHLGCVNDR KKQLRQLFCS LQVQKKASS
Length:439
Mass (Da):51,472
Last modified:November 25, 2008 - v3
Checksum:iED6172FE902F791C
GO
Isoform 2 (identifier: Q3SXZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY
     374-439: LTGREKRVGGFDLMWNDGPVSREEGAPDLSGMGNFVTNTHLGCVNDRKKQLRQLFCSLQVQKKASS → SLRADSPCW

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):41,501
Checksum:iA39458A3476859A1
GO
Isoform 3 (identifier: Q3SXZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     169-191: Missing.
     236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY
     270-439: GCKWTLQRFR...SLQVQKKASS → VAPGGQCVPITDSQQPGRL

Note: No experimental confirmation available.
Show »
Length:230
Mass (Da):27,588
Checksum:i4622BF551667A4FF
GO

Sequence cautioni

The sequence CAI42576 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI42577 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76401 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti274T → M in AAI04026 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03980576Y → C. Corresponds to variant dbSNP:rs17093689Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0357651 – 50Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_035766169 – 191Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_035767236 – 250VFAEC…HRRQD → YIPLRAWLYRDGFARFSNTR FTLNSIDDQY in isoform 2 and isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_035768270 – 439GCKWT…KKASS → VAPGGQCVPITDSQQPGRL in isoform 3. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_035769374 – 439LTGRE…KKASS → SLRADSPCW in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093491 mRNA Translation: BAG52730.1
AL031658, AL359765 Genomic DNA Translation: CAI42576.1 Sequence problems.
AL031658 Genomic DNA Translation: CAI42577.1 Sequence problems.
CH471077 Genomic DNA Translation: EAW76401.1 Sequence problems.
CH471077 Genomic DNA Translation: EAW76403.1
BC104024 mRNA Translation: AAI04025.1
BC104025 mRNA Translation: AAI04026.1
CCDSiCCDS42863.1 [Q3SXZ7-1]
RefSeqiNP_001008409.1, NM_001008409.2 [Q3SXZ7-1]
XP_006723787.1, XM_006723724.2
XP_011526948.1, XM_011528646.1
UniGeneiHs.712915

Genome annotation databases

EnsembliENST00000375938; ENSP00000365105; ENSG00000131044 [Q3SXZ7-1]
ENST00000535842; ENSP00000442515; ENSG00000131044 [Q3SXZ7-1]
GeneIDi164395
KEGGihsa:164395
UCSCiuc002wwy.2 human [Q3SXZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTTLL9_HUMAN
AccessioniPrimary (citable) accession number: Q3SXZ7
Secondary accession number(s): A6NH06
, A6NIS5, B3KSG8, Q3SXZ8, Q5JYS3, Q5JYS4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 25, 2008
Last modified: April 25, 2018
This is version 106 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome