Q3SXZ7 (TTLL9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable tubulin polyglutamylase TTLL9 EC=6.-.-.- Alternative name(s): Tubulin--tyrosine ligase-like protein 9 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 439 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Probably acts when complexed with other proteins By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton › cilium basal body By similarity. Cytoplasm › cytoskeleton By similarity. |
| Sequence similarities | Contains 1 TTL domain. |
| Sequence caution | The sequence CAI42576.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI42577.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAW76401.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell projection Cilium Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Ligase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular protein modification process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cilium Inferred from electronic annotation. Source: UniProtKB-KW cytoplasmInferred from electronic annotation. Source: UniProtKB-KW microtubuleInferred from electronic annotation. Source: UniProtKB-KW microtubule basal bodyInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | tubulin-tyrosine ligase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3SXZ7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3SXZ7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-50: Missing. 236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY 374-439: LTGREKRVGGFDLMWNDGPVSREEGAPDLSGMGNFVTNTHLGCVNDRKKQLRQLFCSLQVQKKASS → SLRADSPCW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q3SXZ7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: Missing. 169-191: Missing. 236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY 270-439: GCKWTLQRFR...SLQVQKKASS → VAPGGQCVPITDSQQPGRL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 439 | 439 | Probable tubulin polyglutamylase TTLL9 | PRO_0000324517 | |||||
Regions | |||||||||
| Domain | 40 – 380 | 341 | TTL | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 50 | 50 | Missing in isoform 2 and isoform 3. | VSP_035765 | |||||
| Alternative sequence | 169 – 191 | 23 | Missing in isoform 3. | VSP_035766 | |||||
| Alternative sequence | 236 – 250 | 15 | VFAEC…HRRQD → YIPLRAWLYRDGFARFSNTR FTLNSIDDQY in isoform 2 and isoform 3. | VSP_035767 | |||||
| Alternative sequence | 270 – 439 | 170 | GCKWT…KKASS → VAPGGQCVPITDSQQPGRL in isoform 3. | VSP_035768 | |||||
| Alternative sequence | 374 – 439 | 66 | LTGRE…KKASS → SLRADSPCW in isoform 2. | VSP_035769 | |||||
| Natural variant | 76 | 1 | Y → C. Corresponds to variant rs17093689 [ dbSNP | Ensembl ]. | VAR_039805 | |||||
Experimental info | |||||||||
| Sequence conflict | 274 | 1 | T → M in AAI04026. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK093491 mRNA. Translation: BAG52730.1. AL031658, AL359765 Genomic DNA. Translation: CAI42576.1. Sequence problems. AL031658 Genomic DNA. Translation: CAI42577.1. Sequence problems. CH471077 Genomic DNA. Translation: EAW76401.1. Sequence problems. CH471077 Genomic DNA. Translation: EAW76403.1. BC104024 mRNA. Translation: AAI04025.1. BC104025 mRNA. Translation: AAI04026.1. |
| IPI | IPI00478718. IPI00651746. IPI00651762. |
| RefSeq | NP_001008409.1. NM_001008409.2. |
| UniGene | Hs.712915. |
3D structure databases | |
| ProteinModelPortal | Q3SXZ7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000365105. |
Polymorphism databases | |
| DMDM | 215274204. |
Proteomic databases | |
| PaxDb | Q3SXZ7. |
| PRIDE | Q3SXZ7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000310998; ENSP00000308980; ENSG00000131044. ENST00000375921; ENSP00000365086; ENSG00000131044. ENST00000375938; ENSP00000365105; ENSG00000131044. ENST00000535842; ENSP00000442515; ENSG00000131044. |
| GeneID | 164395. |
| KEGG | hsa:164395. |
| UCSC | uc010gdx.1. human. |
Organism-specific databases | |
| CTD | 164395. |
| GeneCards | GC20P030458. |
| HGNC | HGNC:16118. TTLL9. |
| HPA | HPA041772. |
| neXtProt | NX_Q3SXZ7. |
| PharmGKB | PA25666. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG311148. |
| HOVERGEN | HBG066341. |
| KO | K16603. |
| OrthoDB | EOG4868CC. |
Gene expression databases | |
| ArrayExpress | Q3SXZ7. |
| Bgee | Q3SXZ7. |
| CleanEx | HS_TTLL9. |
| Genevestigator | Q3SXZ7. |
Family and domain databases | |
| InterPro | IPR004344. Tub_tyr_ligase. [Graphical view] |
| Pfam | PF03133. TTL. 1 hit. [Graphical view] |
| PROSITE | PS51221. TTL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 164395. |
| NextBio | 88466. |
Entry information
| Entry name | TTLL9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q3SXZ7 Secondary accession number(s): A6NH06 Q5JYS4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
