Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic phospholipase A2 epsilon

Gene

PLA2G4E

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.By similarity

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulationi

Stimulated by cytosolic Ca2+.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei400 – 4001NucleophileBy similarity
Active sitei688 – 6881Proton acceptorBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_120722. Acyl chain remodelling of PI.
REACT_120829. Acyl chain remodelling of PC.
REACT_120977. Hydrolysis of LPC.
REACT_121369. Acyl chain remodelling of PE.
REACT_121384. Acyl chain remodelling of PS.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic phospholipase A2 epsilon (EC:3.1.1.4)
Short name:
cPLA2-epsilon
Alternative name(s):
Phospholipase A2 group IVE
Gene namesi
Name:PLA2G4E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:24791. PLA2G4E.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Lysosome, Membrane

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi325511387.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 856856Cytosolic phospholipase A2 epsilonPRO_0000247025Add
BLAST

Proteomic databases

PaxDbiQ3MJ16.
PRIDEiQ3MJ16.

PTM databases

PhosphoSiteiQ3MJ16.

Expressioni

Gene expression databases

BgeeiB7WPN2.
CleanExiHS_PLA2G4E.

Organism-specific databases

HPAiHPA041105.

Interactioni

Protein-protein interaction databases

BioGridi125832. 2 interactions.
STRINGi9606.ENSP00000382434.

Structurei

3D structure databases

ProteinModelPortaliQ3MJ16.
SMRiQ3MJ16. Positions 51-132, 318-849.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 140104C2PROSITE-ProRule annotationAdd
BLAST
Domaini312 – 856545PLA2cPROSITE-ProRule annotationAdd
BLAST

Domaini

The N-terminal C2 domain associates with lipid membranes upon calcium binding. It modulates enzyme activity by presenting the active site to its substrate in response to elevations of cytosolic Ca2+ (By similarity).By similarity

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PLA2c domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG300348.
GeneTreeiENSGT00550000074489.
HOGENOMiHOG000231788.
HOVERGENiHBG080412.
InParanoidiQ3MJ16.
KOiK16342.
OMAiYPKYFQP.
OrthoDBiEOG7Z0JVQ.
PhylomeDBiQ3MJ16.
TreeFamiTF325228.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR000008. C2_dom.
IPR002642. LysoPLipase_cat_dom.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF01735. PLA2_B. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00022. PLAc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS51210. PLA2C. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3MJ16-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLRQMHARV SHSLPDPCQA EDSRPSATCA LKAPQTSWDG LLREGLSPCH
60 70 80 90 100
LLTVRVIRMK NVRQADMLSQ TDCFVSLWLP TASQKKLRTR TISNCPNPEW
110 120 130 140 150
NESFNFQIQS RVKNVLELSV CDEDTVTPDD HLLTVLYDLT KLCFRKKTHV
160 170 180 190 200
KFPLNPQGME ELEVEFLLEE SPSPPETLVT NGVLVVIIFL GSCSSRGHGW
210 220 230 240 250
LLLSGEQDQG RKQWAQLVKD LLVMVNESFE NTQRVRPCLE PCCPTSACFQ
260 270 280 290 300
TAACFHYPKY FQSQVHVEVP KSHWSCGLCC RSRKKGPISQ PLDCLSDGQV
310 320 330 340 350
MTLPVGGGES LGSPETLDVR LGFSLCPAEL EFLQKRKVVV AKALKQVLQL
360 370 380 390 400
EEDLQEDEVP LIAIMATGGG TRSMTSMYGH LLGLQKLNLL DCASYITGLS
410 420 430 440 450
GATWTMATLY RDPDWSSKNL EPAIFEARRH VVKDKLPSLF PDQLRKFQEE
460 470 480 490 500
LRQRSQEGYR VTFTDFWGLL IETCLGDERN ECKLSDQRAA LSCGQNPLPI
510 520 530 540 550
YLTINVKDDV SNQDFREWFE FSPYEVGLQK YGAFIPSELF GSEFFMGRLV
560 570 580 590 600
KRIPESRICY MLGLWSSIFS LNLLDAWNLS HTSEEFFHRW TREKVQDIED
610 620 630 640 650
EPILPEIPKC DANILETTVV IPGSWLSNSF REILTHRSFV SEFHNFLSGL
660 670 680 690 700
QLHTNYLQNG QFSRWKDTVL DGFPNQLTES ANHLCLLDTA FFVNSSYPPL
710 720 730 740 750
LRPERKADLI IHLNYCAGSQ TKPLKQTCEY CTVQNIPFPK YELPDENENL
760 770 780 790 800
KECYLMENPQ EPDAPIVTFF PLINDTFRKY KAPGVERSPE ELEQGQVDIY
810 820 830 840 850
GPKTPYATKE LTYTEATFDK LVKLSEYNIL NNKDTLLQAL RLAVEKKKRL

KGQCPS
Length:856
Mass (Da):97,570
Last modified:March 8, 2011 - v3
Checksum:iEC90486609986E7C
GO
Isoform 2 (identifier: Q3MJ16-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-364: Missing.

Note: No experimental confirmation available.
Show »
Length:492
Mass (Da):56,715
Checksum:i822D145D13FA6545
GO
Isoform 3 (identifier: Q3MJ16-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MLLRQMHARV...PQTSWDGLLR → MSLQASEGCP...FCPMAPWGSE
     186-218: VIIFLGSCSSRGHGWLLLSGEQDQGRKQWAQLV → SRQVSCLEVHAQSRRRRKREKM
     307-313: GGESLGS → ESYELHMKSTPC

Note: No experimental confirmation available.Curated
Show »
Length:868
Mass (Da):99,190
Checksum:iF9A6F33880A5409F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti377 – 3771M → V in BAC87034 (PubMed:14702039).Curated
Sequence conflicti490 – 4901A → P in BAC87034 (PubMed:14702039).Curated
Sequence conflicti678 – 6781T → A in BAC87034 (PubMed:14702039).Curated
Sequence conflicti753 – 7531C → Y in BAC87034 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti388 – 3881N → S.
Corresponds to variant rs4924595 [ dbSNP | Ensembl ].
VAR_027052
Natural varianti681 – 6811A → T.
Corresponds to variant rs8030775 [ dbSNP | Ensembl ].
VAR_027053

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 364364Missing in isoform 2. 1 PublicationVSP_019883Add
BLAST
Alternative sequencei1 – 4343MLLRQ…DGLLR → MSLQASEGCPGLGTNVFVPQ SPQTDEEGSRSGRSFSEFED TQDLDTPGLPPFCPMAPWGS E in isoform 3. VSP_057603Add
BLAST
Alternative sequencei186 – 21833VIIFL…WAQLV → SRQVSCLEVHAQSRRRRKRE KM in isoform 3. VSP_057604Add
BLAST
Alternative sequencei307 – 3137GGESLGS → ESYELHMKSTPC in isoform 3. VSP_057605

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127558 mRNA. Translation: BAC87034.1.
AC039056 Genomic DNA. No translation available.
BC101584 mRNA. Translation: AAI01585.2.
BC101612 mRNA. Translation: AAI01613.2.
RefSeqiNP_001193599.1. NM_001206670.1. [Q3MJ16-3]
UniGeneiHs.668060.

Genome annotation databases

EnsembliENST00000399518; ENSP00000382434; ENSG00000188089. [Q3MJ16-3]
GeneIDi123745.
KEGGihsa:123745.
UCSCiuc001zov.2. human. [Q3MJ16-1]
uc010udc.2. human. [Q3MJ16-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127558 mRNA. Translation: BAC87034.1.
AC039056 Genomic DNA. No translation available.
BC101584 mRNA. Translation: AAI01585.2.
BC101612 mRNA. Translation: AAI01613.2.
RefSeqiNP_001193599.1. NM_001206670.1. [Q3MJ16-3]
UniGeneiHs.668060.

3D structure databases

ProteinModelPortaliQ3MJ16.
SMRiQ3MJ16. Positions 51-132, 318-849.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125832. 2 interactions.
STRINGi9606.ENSP00000382434.

PTM databases

PhosphoSiteiQ3MJ16.

Polymorphism and mutation databases

DMDMi325511387.

Proteomic databases

PaxDbiQ3MJ16.
PRIDEiQ3MJ16.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399518; ENSP00000382434; ENSG00000188089. [Q3MJ16-3]
GeneIDi123745.
KEGGihsa:123745.
UCSCiuc001zov.2. human. [Q3MJ16-1]
uc010udc.2. human. [Q3MJ16-2]

Organism-specific databases

CTDi123745.
GeneCardsiGC15M042273.
HGNCiHGNC:24791. PLA2G4E.
HPAiHPA041105.
neXtProtiNX_Q3MJ16.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG300348.
GeneTreeiENSGT00550000074489.
HOGENOMiHOG000231788.
HOVERGENiHBG080412.
InParanoidiQ3MJ16.
KOiK16342.
OMAiYPKYFQP.
OrthoDBiEOG7Z0JVQ.
PhylomeDBiQ3MJ16.
TreeFamiTF325228.

Enzyme and pathway databases

ReactomeiREACT_120722. Acyl chain remodelling of PI.
REACT_120829. Acyl chain remodelling of PC.
REACT_120977. Hydrolysis of LPC.
REACT_121369. Acyl chain remodelling of PE.
REACT_121384. Acyl chain remodelling of PS.

Miscellaneous databases

GenomeRNAii123745.
NextBioi81141.
PROiQ3MJ16.

Gene expression databases

BgeeiB7WPN2.
CleanExiHS_PLA2G4E.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR000008. C2_dom.
IPR002642. LysoPLipase_cat_dom.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF01735. PLA2_B. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00022. PLAc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS51210. PLA2C. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Tongue.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 354-856.
    Tissue: Heart and Lung.

Entry informationi

Entry nameiPA24E_HUMAN
AccessioniPrimary (citable) accession number: Q3MJ16
Secondary accession number(s): B7WPN2, Q6ZSC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 8, 2011
Last modified: June 24, 2015
This is version 88 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.