Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Diffuse panbronchiolitis critical region protein 1

Gene

DPCR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

  • positive regulation of protein targeting to mitochondrion Source: ParkinsonsUK-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Diffuse panbronchiolitis critical region protein 1
Gene namesi
Name:DPCR1
Synonyms:C6orf37, PBLT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21666. DPCR1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 448419ExtracellularSequence analysisAdd
BLAST
Transmembranei449 – 46921HelicalSequence analysisAdd
BLAST
Topological domaini470 – 51748CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

MalaCardsiDPCR1.
Orphaneti171700. Diffuse panbronchiolitis.
PharmGKBiPA134926573.

Polymorphism and mutation databases

BioMutaiDPCR1.
DMDMi172046709.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence analysisAdd
BLAST
Chaini30 – 517488Diffuse panbronchiolitis critical region protein 1PRO_0000318686Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi88 – 881N-linked (GlcNAc...)Sequence analysis
Glycosylationi124 – 1241N-linked (GlcNAc...)Sequence analysis
Glycosylationi338 – 3381N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PeptideAtlasiQ3MIW9.
PRIDEiQ3MIW9.

PTM databases

iPTMnetiQ3MIW9.
PhosphoSiteiQ3MIW9.

Expressioni

Tissue specificityi

Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine.1 Publication

Developmental stagei

Expressed in fetal heart, kidney and lung.1 Publication

Gene expression databases

BgeeiENSG00000168631.
CleanExiHS_DPCR1.
ExpressionAtlasiQ3MIW9. baseline and differential.
GenevisibleiQ3MIW9. HS.

Organism-specific databases

HPAiHPA014036.

Interactioni

Protein-protein interaction databases

BioGridi126433. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ3MIW9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi172 – 416245Thr-richAdd
BLAST

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000016847.
HOGENOMiHOG000112255.
HOVERGENiHBG107821.
InParanoidiQ3MIW9.
OMAiEDHTIAS.
OrthoDBiEOG091G0D5Q.
PhylomeDBiQ3MIW9.

Family and domain databases

InterProiIPR026623. DPCR1.
[Graphical view]
PANTHERiPTHR22094. PTHR22094. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3MIW9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQPVHSLCS AFGLQCCLLF LLASWGAGAT TFQEYQKTGE LSTSDHIFPL
60 70 80 90 100
TPGLVYSIPF DHIVLHSGQR PPELPKSTEI HEQKRHCNTT RHSKPTDKPT
110 120 130 140 150
GNSKTIDHKS STDNHEAPPT SEENSSNQGK DPMIRNQRSV DPADSTTTHK
160 170 180 190 200
ESAGKKHITP APKSKINCRK STTGKSTVTR KSDKTGRPLE KSMSTLDKTS
210 220 230 240 250
TSSHKTTTSF HNSGNSQTKQ KSTSFPEKIT AASKTTYKTT GTPEESEKTE
260 270 280 290 300
DSRTTVASDK LLTKTTKNIQ ETISANELTQ SLAEPTEHGG RTANENNTPS
310 320 330 340 350
PAEPTENRER TANENKKTIC TKGKNTPVPE KPTENLGNTT LTTETIKAPV
360 370 380 390 400
KSTENPEKTA AVTKTIKPSV KVTGDKSLTT TSSHLNKTEV THQVPTGSFT
410 420 430 440 450
LITSRTKLSS ITSEATGNES HPYLNKDGSQ KGIHAGQMGE NDSFPAWAIV
460 470 480 490 500
IVVLVAVILL LVFLGLIFLV SYMMRTRRTL TQNTQYNDAE DEGGPNSYPV
510
YLMEQQNLGM GQIPSPR
Length:517
Mass (Da):56,347
Last modified:February 26, 2008 - v2
Checksum:iE666F46C167602AF
GO
Isoform 2 (identifier: Q3MIW9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-315: Missing.
     316-316: K → MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSE

Show »
Length:235
Mass (Da):25,701
Checksum:i5C8047CD96CDF033
GO

Sequence cautioni

The sequence CAH56248 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI18455 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti337 – 3371G → R.
Corresponds to variant rs11970154 [ dbSNP | Ensembl ].
VAR_038857
Natural varianti419 – 4191E → K.1 Publication
Corresponds to variant rs3132580 [ dbSNP | Ensembl ].
VAR_038858
Natural varianti517 – 5171R → Q.
Corresponds to variant rs2240804 [ dbSNP | Ensembl ].
VAR_038859

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 315315Missing in isoform 2. 3 PublicationsVSP_031268Add
BLAST
Alternative sequencei316 – 3161K → MTQVTEKSTEHPEKTTSTTE KTTRTPEKPTLYSE in isoform 2. 3 PublicationsVSP_031269

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB064272 mRNA. Translation: BAB82383.1.
AL833738 mRNA. Translation: CAH56248.1. Different initiation.
AL662854 Genomic DNA. No translation available.
AL773541 Genomic DNA. Translation: CAI18455.2. Sequence problems.
AB110931 Genomic DNA. Translation: BAD13697.1.
AB110932 Genomic DNA. Translation: BAD13698.1.
AB202102 Genomic DNA. Translation: BAE78623.1.
BC069477 mRNA. Translation: AAH69477.1.
BC101661 mRNA. Translation: AAI01662.1.
BC101663 mRNA. Translation: AAI01664.1.
RefSeqiNP_543146.2. NM_080870.3.
UniGeneiHs.631993.

Genome annotation databases

EnsembliENST00000304311; ENSP00000305948; ENSG00000168631. [Q3MIW9-1]
ENST00000546848; ENSP00000448383; ENSG00000232251. [Q3MIW9-1]
ENST00000547331; ENSP00000446847; ENSG00000229284. [Q3MIW9-1]
GeneIDi135656.
KEGGihsa:135656.
UCSCiuc063mxo.1. human. [Q3MIW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB064272 mRNA. Translation: BAB82383.1.
AL833738 mRNA. Translation: CAH56248.1. Different initiation.
AL662854 Genomic DNA. No translation available.
AL773541 Genomic DNA. Translation: CAI18455.2. Sequence problems.
AB110931 Genomic DNA. Translation: BAD13697.1.
AB110932 Genomic DNA. Translation: BAD13698.1.
AB202102 Genomic DNA. Translation: BAE78623.1.
BC069477 mRNA. Translation: AAH69477.1.
BC101661 mRNA. Translation: AAI01662.1.
BC101663 mRNA. Translation: AAI01664.1.
RefSeqiNP_543146.2. NM_080870.3.
UniGeneiHs.631993.

3D structure databases

ProteinModelPortaliQ3MIW9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126433. 1 interaction.

PTM databases

iPTMnetiQ3MIW9.
PhosphoSiteiQ3MIW9.

Polymorphism and mutation databases

BioMutaiDPCR1.
DMDMi172046709.

Proteomic databases

PeptideAtlasiQ3MIW9.
PRIDEiQ3MIW9.

Protocols and materials databases

DNASUi135656.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304311; ENSP00000305948; ENSG00000168631. [Q3MIW9-1]
ENST00000546848; ENSP00000448383; ENSG00000232251. [Q3MIW9-1]
ENST00000547331; ENSP00000446847; ENSG00000229284. [Q3MIW9-1]
GeneIDi135656.
KEGGihsa:135656.
UCSCiuc063mxo.1. human. [Q3MIW9-1]

Organism-specific databases

CTDi135656.
GeneCardsiDPCR1.
HGNCiHGNC:21666. DPCR1.
HPAiHPA014036.
MalaCardsiDPCR1.
MIMi613928. gene.
neXtProtiNX_Q3MIW9.
Orphaneti171700. Diffuse panbronchiolitis.
PharmGKBiPA134926573.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000016847.
HOGENOMiHOG000112255.
HOVERGENiHBG107821.
InParanoidiQ3MIW9.
OMAiEDHTIAS.
OrthoDBiEOG091G0D5Q.
PhylomeDBiQ3MIW9.

Miscellaneous databases

ChiTaRSiDPCR1. human.
GenomeRNAii135656.
PROiQ3MIW9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168631.
CleanExiHS_DPCR1.
ExpressionAtlasiQ3MIW9. baseline and differential.
GenevisibleiQ3MIW9. HS.

Family and domain databases

InterProiIPR026623. DPCR1.
[Graphical view]
PANTHERiPTHR22094. PTHR22094. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiDPCR1_HUMAN
AccessioniPrimary (citable) accession number: Q3MIW9
Secondary accession number(s): C9IZC0, Q658M7, Q8WYN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: September 7, 2016
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.