Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3KR16

- PKHG6_HUMAN

UniProt

Q3KR16 - PKHG6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pleckstrin homology domain-containing family G member 6

Gene

PLEKHG6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving PLEKHG6, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis.2 Publications

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW
  2. Rho guanyl-nucleotide exchange factor activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family G member 6
Short name:
PH domain-containing family G member 6
Alternative name(s):
Myosin-interacting guanine nucleotide exchange factor
Short name:
MyoGEF
Gene namesi
Name:PLEKHG6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:25562. PLEKHG6.

Subcellular locationi

Cytoplasm. Cytoplasmcytoskeletonspindle. Cytoplasmcytoskeletonspindle pole. Cleavage furrow
Note: During mitosis, localizes to the spindle pole, central spindle and cleavage furrow. In epithelial cells, recruited to the apical membrane by EZR.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi351 – 3511N → A: Loss of exchange activity. 1 Publication

Organism-specific databases

PharmGKBiPA142671165.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 790790Pleckstrin homology domain-containing family G member 6PRO_0000307912Add
BLAST

Proteomic databases

PaxDbiQ3KR16.
PRIDEiQ3KR16.

PTM databases

PhosphoSiteiQ3KR16.

Expressioni

Tissue specificityi

Highest expression in the placenta. Low levels in small intestine, lung, liver, kidney, thymus and heart.

Gene expression databases

BgeeiQ3KR16.
CleanExiHS_PLEKHG6.
ExpressionAtlasiQ3KR16. baseline and differential.
GenevestigatoriQ3KR16.

Organism-specific databases

HPAiHPA041459.

Interactioni

Subunit structurei

Interacts with MYH10. Interacts with ELMO1 and EZR (in an open conformation). Interacts with CSPP1.3 Publications

Protein-protein interaction databases

BioGridi120497. 1 interaction.
STRINGi9606.ENSP00000011684.

Structurei

3D structure databases

ProteinModelPortaliQ3KR16.
SMRiQ3KR16. Positions 145-507.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini161 – 353193DHPROSITE-ProRule annotationAdd
BLAST
Domaini409 – 509101PHPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi364 – 3674Poly-Ala
Compositional biasi714 – 7185Poly-Glu

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5422.
GeneTreeiENSGT00510000046843.
HOGENOMiHOG000169625.
HOVERGENiHBG108257.
InParanoidiQ3KR16.
OMAiHLTEFQC.
OrthoDBiEOG73BVDB.
PhylomeDBiQ3KR16.
TreeFamiTF316755.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR015721. RhoGEF-like.
[Graphical view]
PANTHERiPTHR22825. PTHR22825. 1 hit.
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3KR16-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAFGPPHEG PLQGLVASRI ETYGGRHRAS AQSTAGRLYP RGYPVLDPSR
60 70 80 90 100
RRLQQYVPFA RGSGQARGLS PMRLRDPEPE KRHGGHVGAG LLHSPKLKEL
110 120 130 140 150
TKAHELEVRL HTFSMFGMPR LPPEDRRHWE IGEGGDSGLT IEKSWRELVP
160 170 180 190 200
GHKEMSQELC HQQEALWELL TTELIYVRKL KIMTDLLAAG LLNLQRVGLL
210 220 230 240 250
MEVSAETLFG NVPSLIRTHR SFWDEVLGPT LEETRASGQP LDPIGLQSGF
260 270 280 290 300
LTFGQRFHPY VQYCLRVKQT MAYAREQQET NPLFHAFVQW CEKHKRSGRQ
310 320 330 340 350
MLCDLLIKPH QRITKYPLLL HAVLKRSPEA RAQEALNAMI EAVESFLRHI
360 370 380 390 400
NGQVRQGEEQ ESLAAAAQRI GPYEVLEPPS DEVEKNLRPF STLDLTSPML
410 420 430 440 450
GVASEHTRQL LLEGPVRVKE GREGKLDVYL FLFSDVLLVT KPQRKADKAK
460 470 480 490 500
VIRPPLMLEK LVCQPLRDPN SFLLIHLTEF QCVSSALLVH CPSPTDRAQW
510 520 530 540 550
LEKTQQAQAA LQKLKAEEYV QQKRELLTLY RDQDRESPST RPSTPSLEGS
560 570 580 590 600
QSSAEGRTPE FSTIIPHLVV TEDTDEDAPL VPDDTSDSGY GTLIPGTPTG
610 620 630 640 650
SRSPLSRLRQ RALRRDPRLT FSTLELRDIP LRPHPPDPQA PQRRSAPELP
660 670 680 690 700
EGILKGGSLP QEDPPTWSEE EDGASERGNV VVETLHRARL RGQLPSSPTH
710 720 730 740 750
ADSAGESPWE SSGEEEEEGP LFLKAGHTSL RPMRAEDMLR EIREELASQR
760 770 780 790
IEGAEEPRDS RPRKLTRAQL QRMRGPHIIQ LDTPLSASEV
Length:790
Mass (Da):88,960
Last modified:May 3, 2011 - v3
Checksum:i34A2555DEF431EF4
GO
Isoform 2 (identifier: Q3KR16-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVL → MGCRLHAPGEKAAH

Note: No experimental confirmation available.

Show »
Length:758
Mass (Da):85,486
Checksum:i403CED373E96DA23
GO
Isoform 3 (identifier: Q3KR16-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-470: Missing.
     471-508: SFLLIHLTEF...QWLEKTQQAQ → MCPREGGRAS...GEPKIQHPLK

Note: No experimental confirmation available.

Show »
Length:320
Mass (Da):35,568
Checksum:i4A0D7A82830B807F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti384 – 3841E → G in AAI04752. (PubMed:15489334)Curated
Sequence conflicti459 – 4591E → D in BAA91741. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti35 – 351A → T.2 Publications
Corresponds to variant rs740842 [ dbSNP | Ensembl ].
VAR_036710

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 470470Missing in isoform 3. 1 PublicationVSP_028856Add
BLAST
Alternative sequencei1 – 4646MKAFG…GYPVL → MGCRLHAPGEKAAH in isoform 2. 1 PublicationVSP_028857Add
BLAST
Alternative sequencei471 – 50838SFLLI…TQQAQ → MCPREGGRASTIHQKTEKAF GQLLCQPLGEPKIQHPLK in isoform 3. 1 PublicationVSP_028858Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001527 mRNA. Translation: BAA91741.1.
AK095373 mRNA. Translation: BAC04539.1.
AF289613 mRNA. Translation: AAL55797.1.
BC104751 mRNA. Translation: AAI04752.1.
BC105961 mRNA. Translation: AAI05962.1.
BC109095 mRNA. Translation: AAI09096.1.
AC006057 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88809.1.
CCDSiCCDS44808.1. [Q3KR16-2]
CCDS8541.1. [Q3KR16-1]
RefSeqiNP_001138328.1. NM_001144856.1. [Q3KR16-1]
NP_001138329.1. NM_001144857.1. [Q3KR16-2]
NP_060643.2. NM_018173.3. [Q3KR16-1]
XP_005253761.1. XM_005253704.2. [Q3KR16-1]
UniGeneiHs.631660.

Genome annotation databases

EnsembliENST00000011684; ENSP00000011684; ENSG00000008323. [Q3KR16-1]
ENST00000304581; ENSP00000304640; ENSG00000008323. [Q3KR16-3]
ENST00000396988; ENSP00000380185; ENSG00000008323. [Q3KR16-1]
ENST00000449001; ENSP00000393194; ENSG00000008323. [Q3KR16-2]
GeneIDi55200.
KEGGihsa:55200.
UCSCiuc001qnr.3. human. [Q3KR16-1]
uc010sex.2. human. [Q3KR16-2]

Polymorphism databases

DMDMi332278231.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001527 mRNA. Translation: BAA91741.1 .
AK095373 mRNA. Translation: BAC04539.1 .
AF289613 mRNA. Translation: AAL55797.1 .
BC104751 mRNA. Translation: AAI04752.1 .
BC105961 mRNA. Translation: AAI05962.1 .
BC109095 mRNA. Translation: AAI09096.1 .
AC006057 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88809.1 .
CCDSi CCDS44808.1. [Q3KR16-2 ]
CCDS8541.1. [Q3KR16-1 ]
RefSeqi NP_001138328.1. NM_001144856.1. [Q3KR16-1 ]
NP_001138329.1. NM_001144857.1. [Q3KR16-2 ]
NP_060643.2. NM_018173.3. [Q3KR16-1 ]
XP_005253761.1. XM_005253704.2. [Q3KR16-1 ]
UniGenei Hs.631660.

3D structure databases

ProteinModelPortali Q3KR16.
SMRi Q3KR16. Positions 145-507.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120497. 1 interaction.
STRINGi 9606.ENSP00000011684.

PTM databases

PhosphoSitei Q3KR16.

Polymorphism databases

DMDMi 332278231.

Proteomic databases

PaxDbi Q3KR16.
PRIDEi Q3KR16.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000011684 ; ENSP00000011684 ; ENSG00000008323 . [Q3KR16-1 ]
ENST00000304581 ; ENSP00000304640 ; ENSG00000008323 . [Q3KR16-3 ]
ENST00000396988 ; ENSP00000380185 ; ENSG00000008323 . [Q3KR16-1 ]
ENST00000449001 ; ENSP00000393194 ; ENSG00000008323 . [Q3KR16-2 ]
GeneIDi 55200.
KEGGi hsa:55200.
UCSCi uc001qnr.3. human. [Q3KR16-1 ]
uc010sex.2. human. [Q3KR16-2 ]

Organism-specific databases

CTDi 55200.
GeneCardsi GC12P006419.
HGNCi HGNC:25562. PLEKHG6.
HPAi HPA041459.
MIMi 611743. gene.
neXtProti NX_Q3KR16.
PharmGKBi PA142671165.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5422.
GeneTreei ENSGT00510000046843.
HOGENOMi HOG000169625.
HOVERGENi HBG108257.
InParanoidi Q3KR16.
OMAi HLTEFQC.
OrthoDBi EOG73BVDB.
PhylomeDBi Q3KR16.
TreeFami TF316755.

Miscellaneous databases

ChiTaRSi PLEKHG6. human.
GenomeRNAii 55200.
NextBioi 59086.
PROi Q3KR16.
SOURCEi Search...

Gene expression databases

Bgeei Q3KR16.
CleanExi HS_PLEKHG6.
ExpressionAtlasi Q3KR16. baseline and differential.
Genevestigatori Q3KR16.

Family and domain databases

Gene3Di 1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR015721. RhoGEF-like.
[Graphical view ]
PANTHERi PTHR22825. PTHR22825. 1 hit.
Pfami PF00621. RhoGEF. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view ]
SUPFAMi SSF48065. SSF48065. 1 hit.
PROSITEi PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-35.
    Tissue: Tongue.
  2. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-35.
  6. "A novel guanine nucleotide exchange factor MyoGEF is required for cytokinesis."
    Wu D., Asiedu M., Adelstein R.S., Wei Q.
    Cell Cycle 5:1234-1239(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MYH10, SUBCELLULAR LOCATION.
  7. "Interaction of ezrin with the novel guanine nucleotide exchange factor PLEKHG6 promotes RhoG-dependent apical cytoskeleton rearrangements in epithelial cells."
    D'Angelo R., Aresta S., Blangy A., Del Maestro L., Louvard D., Arpin M.
    Mol. Biol. Cell 18:4780-4793(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ELMO1 AND EZR, SUBCELLULAR LOCATION, MUTAGENESIS OF ASN-351.
  8. "Centrosome/spindle pole-associated protein regulates cytokinesis via promoting the recruitment of MyoGEF to the central spindle."
    Asiedu M., Wu D., Matsumura F., Wei Q.
    Mol. Biol. Cell 20:1428-1440(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CSPP1.

Entry informationi

Entry nameiPKHG6_HUMAN
AccessioniPrimary (citable) accession number: Q3KR16
Secondary accession number(s): Q3SWR1
, Q8N1P1, Q8WYY1, Q9H8F4, Q9NVK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 3, 2011
Last modified: October 29, 2014
This is version 89 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3