Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q3KR16

- PKHG6_HUMAN

UniProt

Q3KR16 - PKHG6_HUMAN

Protein

Pleckstrin homology domain-containing family G member 6

Gene

PLEKHG6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 3 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving PLEKHG6, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis.2 Publications

    GO - Molecular functioni

    1. GTPase activator activity Source: UniProtKB-KW
    2. protein binding Source: UniProtKB
    3. Rho guanyl-nucleotide exchange factor activity Source: InterPro

    Keywords - Molecular functioni

    GTPase activation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pleckstrin homology domain-containing family G member 6
    Short name:
    PH domain-containing family G member 6
    Alternative name(s):
    Myosin-interacting guanine nucleotide exchange factor
    Short name:
    MyoGEF
    Gene namesi
    Name:PLEKHG6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:25562. PLEKHG6.

    Subcellular locationi

    Cytoplasm. Cytoplasmcytoskeletonspindle. Cytoplasmcytoskeletonspindle pole. Cleavage furrow
    Note: During mitosis, localizes to the spindle pole, central spindle and cleavage furrow. In epithelial cells, recruited to the apical membrane by EZR.

    GO - Cellular componenti

    1. cleavage furrow Source: UniProtKB-SubCell
    2. cytoplasm Source: UniProtKB-SubCell
    3. spindle pole Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi351 – 3511N → A: Loss of exchange activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA142671165.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 790790Pleckstrin homology domain-containing family G member 6PRO_0000307912Add
    BLAST

    Proteomic databases

    PaxDbiQ3KR16.
    PRIDEiQ3KR16.

    PTM databases

    PhosphoSiteiQ3KR16.

    Expressioni

    Tissue specificityi

    Highest expression in the placenta. Low levels in small intestine, lung, liver, kidney, thymus and heart.

    Gene expression databases

    ArrayExpressiQ3KR16.
    BgeeiQ3KR16.
    CleanExiHS_PLEKHG6.
    GenevestigatoriQ3KR16.

    Organism-specific databases

    HPAiHPA041459.

    Interactioni

    Subunit structurei

    Interacts with MYH10. Interacts with ELMO1 and EZR (in an open conformation). Interacts with CSPP1.3 Publications

    Protein-protein interaction databases

    BioGridi120497. 1 interaction.
    STRINGi9606.ENSP00000011684.

    Structurei

    3D structure databases

    ProteinModelPortaliQ3KR16.
    SMRiQ3KR16. Positions 145-507.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini161 – 353193DHPROSITE-ProRule annotationAdd
    BLAST
    Domaini409 – 509101PHPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi364 – 3674Poly-Ala
    Compositional biasi714 – 7185Poly-Glu

    Sequence similaritiesi

    Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5422.
    HOGENOMiHOG000169625.
    HOVERGENiHBG108257.
    InParanoidiQ3KR16.
    OMAiHLTEFQC.
    OrthoDBiEOG73BVDB.
    PhylomeDBiQ3KR16.
    TreeFamiTF316755.

    Family and domain databases

    Gene3Di1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR015721. RhoGEF-like.
    [Graphical view]
    PANTHERiPTHR22825. PTHR22825. 1 hit.
    PfamiPF00621. RhoGEF. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    [Graphical view]
    SUPFAMiSSF48065. SSF48065. 1 hit.
    PROSITEiPS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q3KR16-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKAFGPPHEG PLQGLVASRI ETYGGRHRAS AQSTAGRLYP RGYPVLDPSR    50
    RRLQQYVPFA RGSGQARGLS PMRLRDPEPE KRHGGHVGAG LLHSPKLKEL 100
    TKAHELEVRL HTFSMFGMPR LPPEDRRHWE IGEGGDSGLT IEKSWRELVP 150
    GHKEMSQELC HQQEALWELL TTELIYVRKL KIMTDLLAAG LLNLQRVGLL 200
    MEVSAETLFG NVPSLIRTHR SFWDEVLGPT LEETRASGQP LDPIGLQSGF 250
    LTFGQRFHPY VQYCLRVKQT MAYAREQQET NPLFHAFVQW CEKHKRSGRQ 300
    MLCDLLIKPH QRITKYPLLL HAVLKRSPEA RAQEALNAMI EAVESFLRHI 350
    NGQVRQGEEQ ESLAAAAQRI GPYEVLEPPS DEVEKNLRPF STLDLTSPML 400
    GVASEHTRQL LLEGPVRVKE GREGKLDVYL FLFSDVLLVT KPQRKADKAK 450
    VIRPPLMLEK LVCQPLRDPN SFLLIHLTEF QCVSSALLVH CPSPTDRAQW 500
    LEKTQQAQAA LQKLKAEEYV QQKRELLTLY RDQDRESPST RPSTPSLEGS 550
    QSSAEGRTPE FSTIIPHLVV TEDTDEDAPL VPDDTSDSGY GTLIPGTPTG 600
    SRSPLSRLRQ RALRRDPRLT FSTLELRDIP LRPHPPDPQA PQRRSAPELP 650
    EGILKGGSLP QEDPPTWSEE EDGASERGNV VVETLHRARL RGQLPSSPTH 700
    ADSAGESPWE SSGEEEEEGP LFLKAGHTSL RPMRAEDMLR EIREELASQR 750
    IEGAEEPRDS RPRKLTRAQL QRMRGPHIIQ LDTPLSASEV 790
    Length:790
    Mass (Da):88,960
    Last modified:May 3, 2011 - v3
    Checksum:i34A2555DEF431EF4
    GO
    Isoform 2 (identifier: Q3KR16-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVL → MGCRLHAPGEKAAH

    Note: No experimental confirmation available.

    Show »
    Length:758
    Mass (Da):85,486
    Checksum:i403CED373E96DA23
    GO
    Isoform 3 (identifier: Q3KR16-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-470: Missing.
         471-508: SFLLIHLTEF...QWLEKTQQAQ → MCPREGGRAS...GEPKIQHPLK

    Note: No experimental confirmation available.

    Show »
    Length:320
    Mass (Da):35,568
    Checksum:i4A0D7A82830B807F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti384 – 3841E → G in AAI04752. (PubMed:15489334)Curated
    Sequence conflicti459 – 4591E → D in BAA91741. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti35 – 351A → T.2 Publications
    Corresponds to variant rs740842 [ dbSNP | Ensembl ].
    VAR_036710

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 470470Missing in isoform 3. 1 PublicationVSP_028856Add
    BLAST
    Alternative sequencei1 – 4646MKAFG…GYPVL → MGCRLHAPGEKAAH in isoform 2. 1 PublicationVSP_028857Add
    BLAST
    Alternative sequencei471 – 50838SFLLI…TQQAQ → MCPREGGRASTIHQKTEKAF GQLLCQPLGEPKIQHPLK in isoform 3. 1 PublicationVSP_028858Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001527 mRNA. Translation: BAA91741.1.
    AK095373 mRNA. Translation: BAC04539.1.
    AF289613 mRNA. Translation: AAL55797.1.
    BC104751 mRNA. Translation: AAI04752.1.
    BC105961 mRNA. Translation: AAI05962.1.
    BC109095 mRNA. Translation: AAI09096.1.
    AC006057 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88809.1.
    CCDSiCCDS44808.1. [Q3KR16-2]
    CCDS8541.1. [Q3KR16-1]
    RefSeqiNP_001138328.1. NM_001144856.1. [Q3KR16-1]
    NP_001138329.1. NM_001144857.1. [Q3KR16-2]
    NP_060643.2. NM_018173.3. [Q3KR16-1]
    XP_005253761.1. XM_005253704.2. [Q3KR16-1]
    UniGeneiHs.631660.

    Genome annotation databases

    EnsembliENST00000011684; ENSP00000011684; ENSG00000008323. [Q3KR16-1]
    ENST00000304581; ENSP00000304640; ENSG00000008323. [Q3KR16-3]
    ENST00000396988; ENSP00000380185; ENSG00000008323. [Q3KR16-1]
    ENST00000449001; ENSP00000393194; ENSG00000008323. [Q3KR16-2]
    GeneIDi55200.
    KEGGihsa:55200.
    UCSCiuc001qnr.3. human. [Q3KR16-1]
    uc010sex.2. human. [Q3KR16-2]

    Polymorphism databases

    DMDMi332278231.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001527 mRNA. Translation: BAA91741.1 .
    AK095373 mRNA. Translation: BAC04539.1 .
    AF289613 mRNA. Translation: AAL55797.1 .
    BC104751 mRNA. Translation: AAI04752.1 .
    BC105961 mRNA. Translation: AAI05962.1 .
    BC109095 mRNA. Translation: AAI09096.1 .
    AC006057 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88809.1 .
    CCDSi CCDS44808.1. [Q3KR16-2 ]
    CCDS8541.1. [Q3KR16-1 ]
    RefSeqi NP_001138328.1. NM_001144856.1. [Q3KR16-1 ]
    NP_001138329.1. NM_001144857.1. [Q3KR16-2 ]
    NP_060643.2. NM_018173.3. [Q3KR16-1 ]
    XP_005253761.1. XM_005253704.2. [Q3KR16-1 ]
    UniGenei Hs.631660.

    3D structure databases

    ProteinModelPortali Q3KR16.
    SMRi Q3KR16. Positions 145-507.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120497. 1 interaction.
    STRINGi 9606.ENSP00000011684.

    PTM databases

    PhosphoSitei Q3KR16.

    Polymorphism databases

    DMDMi 332278231.

    Proteomic databases

    PaxDbi Q3KR16.
    PRIDEi Q3KR16.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000011684 ; ENSP00000011684 ; ENSG00000008323 . [Q3KR16-1 ]
    ENST00000304581 ; ENSP00000304640 ; ENSG00000008323 . [Q3KR16-3 ]
    ENST00000396988 ; ENSP00000380185 ; ENSG00000008323 . [Q3KR16-1 ]
    ENST00000449001 ; ENSP00000393194 ; ENSG00000008323 . [Q3KR16-2 ]
    GeneIDi 55200.
    KEGGi hsa:55200.
    UCSCi uc001qnr.3. human. [Q3KR16-1 ]
    uc010sex.2. human. [Q3KR16-2 ]

    Organism-specific databases

    CTDi 55200.
    GeneCardsi GC12P006419.
    HGNCi HGNC:25562. PLEKHG6.
    HPAi HPA041459.
    MIMi 611743. gene.
    neXtProti NX_Q3KR16.
    PharmGKBi PA142671165.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5422.
    HOGENOMi HOG000169625.
    HOVERGENi HBG108257.
    InParanoidi Q3KR16.
    OMAi HLTEFQC.
    OrthoDBi EOG73BVDB.
    PhylomeDBi Q3KR16.
    TreeFami TF316755.

    Miscellaneous databases

    ChiTaRSi PLEKHG6. human.
    GenomeRNAii 55200.
    NextBioi 59086.
    PROi Q3KR16.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q3KR16.
    Bgeei Q3KR16.
    CleanExi HS_PLEKHG6.
    Genevestigatori Q3KR16.

    Family and domain databases

    Gene3Di 1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR015721. RhoGEF-like.
    [Graphical view ]
    PANTHERi PTHR22825. PTHR22825. 1 hit.
    Pfami PF00621. RhoGEF. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48065. SSF48065. 1 hit.
    PROSITEi PS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-35.
      Tissue: Tongue.
    2. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-35.
    6. "A novel guanine nucleotide exchange factor MyoGEF is required for cytokinesis."
      Wu D., Asiedu M., Adelstein R.S., Wei Q.
      Cell Cycle 5:1234-1239(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MYH10, SUBCELLULAR LOCATION.
    7. "Interaction of ezrin with the novel guanine nucleotide exchange factor PLEKHG6 promotes RhoG-dependent apical cytoskeleton rearrangements in epithelial cells."
      D'Angelo R., Aresta S., Blangy A., Del Maestro L., Louvard D., Arpin M.
      Mol. Biol. Cell 18:4780-4793(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ELMO1 AND EZR, SUBCELLULAR LOCATION, MUTAGENESIS OF ASN-351.
    8. "Centrosome/spindle pole-associated protein regulates cytokinesis via promoting the recruitment of MyoGEF to the central spindle."
      Asiedu M., Wu D., Matsumura F., Wei Q.
      Mol. Biol. Cell 20:1428-1440(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CSPP1.

    Entry informationi

    Entry nameiPKHG6_HUMAN
    AccessioniPrimary (citable) accession number: Q3KR16
    Secondary accession number(s): Q3SWR1
    , Q8N1P1, Q8WYY1, Q9H8F4, Q9NVK9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 88 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3