Reviewed,
UniProtKB/Swiss-Prot Q3KP44 (ANR55_HUMAN)
Last modified
November 24, 2009.
Version 37.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Ankyrin repeat domain-containing protein 55 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 613 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Repeat |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3KP44-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3KP44-2) The sequence of this isoform differs from the canonical sequence as follows: 1-287: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q3KP44-3) The sequence of this isoform differs from the canonical sequence as follows: 1-287: Missing. 288-320: MDSNLRDINESTPLAYALYCGHTACVKLLSQES → ML | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 613 | 613 | Ankyrin repeat domain-containing protein 55 | PRO_0000274410 | |||||
Regions | |||||||||
| Repeat | 25 – 54 | 30 | ANK 1 | ||||||
| Repeat | 59 – 88 | 30 | ANK 2 | ||||||
| Repeat | 92 – 124 | 33 | ANK 3 | ||||||
| Repeat | 125 – 156 | 32 | ANK 4 | ||||||
| Repeat | 160 – 189 | 30 | ANK 5 | ||||||
| Repeat | 193 – 222 | 30 | ANK 6 | ||||||
| Repeat | 229 – 259 | 31 | ANK 7 | ||||||
| Repeat | 263 – 292 | 30 | ANK 8 | ||||||
| Repeat | 296 – 325 | 30 | ANK 9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 287 | 287 | Missing in isoform 2 and isoform 3. | VSP_022740 | |||||
| Alternative sequence | 288 – 320 | 33 | MDSNL…LSQES → ML in isoform 3. | VSP_022741 | |||||
| Natural variant | 344 | 1 | V → M: dbSNP rs321776. Ref.3 | VAR_030283 | |||||
| Natural variant | 593 | 1 | R → Q: dbSNP rs34879141. | VAR_055516 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Embryo. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-344. |
Cross-references
Sequence databases | |
|---|---|
| AK021857 mRNA. Translation: BAB13916.1. AC016585 Genomic DNA. No translation available. AC016638 Genomic DNA. No translation available. BC106914 mRNA. Translation: AAI06915.1. BC106915 mRNA. Translation: AAI06916.1. | |
| IPI | IPI00002928. IPI00413655. IPI00827545. |
| RefSeq | NP_001035024.1. NP_078945.2. |
| UniGene | Hs.436214 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q3KP44. |
Genome annotation databases | |
| Ensembl | ENST00000341048; ENSP00000342295; ENSG00000164512; Homo sapiens. [Genome view] |
| GeneID | 79722. |
| KEGG | hsa:79722. |
| NMPDR | fig|9606.3.peg.25265. |
| UCSC | uc003jqt.1. human. |
Organism-specific databases | |
| CTD | 79722. |
| GeneCards | GC05M055432. |
| HGNC | HGNC:25681. ANKRD55. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q3KP44. |
| OMA | PLAYALY |
Gene expression databases | |
| ArrayExpress | Q3KP44. |
| Bgee | Q3KP44. |
| CleanEx | HS_ANKRD55. |
| Genevestigator | Q3KP44. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. |
| Pfam | PF00023. Ank. 8 hits. [Graphical view] |
| SMART | SM00248. ANK. 9 hits. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 69076. |
Entry information
| Entry name | ANR55_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q3KP44 Secondary accession number(s): Q3KP45, Q9HAD3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with


