Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat domain-containing protein 55

Gene

ANKRD55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 55
Gene namesi
Name:ANKRD55
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:25681. ANKRD55.

Pathology & Biotechi

Organism-specific databases

MalaCardsiANKRD55.
Orphaneti85408. Juvenile rheumatoid factor-negative polyarthritis.
802. Multiple sclerosis.
85410. Oligoarticular juvenile arthritis.
PharmGKBiPA145149863.

Polymorphism and mutation databases

BioMutaiANKRD55.
DMDMi408360322.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 614614Ankyrin repeat domain-containing protein 55PRO_0000274410Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei475 – 4751PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ3KP44.
PeptideAtlasiQ3KP44.
PRIDEiQ3KP44.

PTM databases

iPTMnetiQ3KP44.
PhosphoSiteiQ3KP44.

Expressioni

Gene expression databases

BgeeiQ3KP44.
CleanExiHS_ANKRD55.
ExpressionAtlasiQ3KP44. baseline and differential.
GenevisibleiQ3KP44. HS.

Organism-specific databases

HPAiHPA051049.

Interactioni

Protein-protein interaction databases

BioGridi122837. 11 interactions.
STRINGi9606.ENSP00000342295.

Structurei

3D structure databases

ProteinModelPortaliQ3KP44.
SMRiQ3KP44. Positions 21-402.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati26 – 5530ANK 1Add
BLAST
Repeati60 – 8930ANK 2Add
BLAST
Repeati93 – 12533ANK 3Add
BLAST
Repeati126 – 15732ANK 4Add
BLAST
Repeati161 – 19030ANK 5Add
BLAST
Repeati194 – 22330ANK 6Add
BLAST
Repeati230 – 26031ANK 7Add
BLAST
Repeati264 – 29330ANK 8Add
BLAST
Repeati297 – 32630ANK 9Add
BLAST

Sequence similaritiesi

Contains 9 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129770.
HOGENOMiHOG000285984.
HOVERGENiHBG080859.
InParanoidiQ3KP44.
OMAiDQQKGDS.
OrthoDBiEOG7DNNTN.
PhylomeDBiQ3KP44.
TreeFamiTF315452.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
[Graphical view]
SMARTiSM00248. ANK. 9 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3KP44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMRQATMDFS TPSVFDQQRG DSSEEVDLTM VYQAASNGDV NALTAVIRED
60 70 80 90 100
PSILECCDSE GCTPLMHAVS GRQADTVKLL LKMGANINMQ DAYGRTSLCL
110 120 130 140 150
ATYLGWLEGC VSLLRNGAKH NIPDKNGRLP LHAATAEPDM RLLTVLLQQS
160 170 180 190 200
NISEINHQDN EGMTPLHWAA FHNQPQHTQM LLKKGADPTL VDKDFKTALH
210 220 230 240 250
WAVQSGNRIL CSIILSHHQG PSIINYDDES GKTCVHIAAA AGFSDIIHEL
260 270 280 290 300
ARVPECNLQA LDVDDRTPLH WAAAAGKAEC VQSLLELGMD SNLRDINEST
310 320 330 340 350
PLAYALYCGH TACVKLLSQE SRTEPTRPPP SQSSRPQKKE RRFNVLNQIF
360 370 380 390 400
CKNKKEEQRA HQKDPSRDRY REEDTSEVND IITTFDSIVG TNCQEQPGDQ
410 420 430 440 450
VAMVEFKKKT SDNSKYLLPE KKPLARKGLP PIRTQSLPPI TLGNNFLTAS
460 470 480 490 500
HRATSHAGLS SAPHHMAQRS QKSRSEQDLL NNRTGCQMLL DNPWKSDSNQ
510 520 530 540 550
VFSYKVWTVS SSDKLLDRLL SVRPGHQEVS VPPHLRHLHN PSSGQNFQHL
560 570 580 590 600
SPNRHKIRDL PFTRNNLAPL PDQKFLSGEP LRTNRVLPAI PSQRRHSTAA
610
EESEHSANPT SDEN
Length:614
Mass (Da):68,414
Last modified:October 3, 2012 - v3
Checksum:i1B2BFC5ED5A72960
GO
Isoform 2 (identifier: Q3KP44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.

Note: No experimental confirmation available.
Show »
Length:326
Mass (Da):36,983
Checksum:i152A2224959EA5D7
GO
Isoform 3 (identifier: Q3KP44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.
     289-321: MDSNLRDINESTPLAYALYCGHTACVKLLSQES → ML

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,602
Checksum:i57B698E79F5BA6C2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti345 – 3451V → M.1 Publication
Corresponds to variant rs321776 [ dbSNP | Ensembl ].
VAR_030283
Natural varianti594 – 5941R → Q.
Corresponds to variant rs34879141 [ dbSNP | Ensembl ].
VAR_055516

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 288288Missing in isoform 2 and isoform 3. 2 PublicationsVSP_022740Add
BLAST
Alternative sequencei289 – 32133MDSNL…LSQES → ML in isoform 3. 1 PublicationVSP_022741Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021857 mRNA. Translation: BAB13916.1.
AK123389 mRNA. Translation: BAG53900.1.
AC016585 Genomic DNA. No translation available.
AC016638 Genomic DNA. No translation available.
CH471123 Genomic DNA. Translation: EAW54941.1.
BC106914 mRNA. Translation: AAI06915.1.
BC106915 mRNA. Translation: AAI06916.1.
CCDSiCCDS34161.1. [Q3KP44-1]
RefSeqiNP_078945.2. NM_024669.2. [Q3KP44-1]
UniGeneiHs.436214.

Genome annotation databases

EnsembliENST00000341048; ENSP00000342295; ENSG00000164512. [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512. [Q3KP44-2]
GeneIDi79722.
KEGGihsa:79722.
UCSCiuc003jqt.4. human. [Q3KP44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021857 mRNA. Translation: BAB13916.1.
AK123389 mRNA. Translation: BAG53900.1.
AC016585 Genomic DNA. No translation available.
AC016638 Genomic DNA. No translation available.
CH471123 Genomic DNA. Translation: EAW54941.1.
BC106914 mRNA. Translation: AAI06915.1.
BC106915 mRNA. Translation: AAI06916.1.
CCDSiCCDS34161.1. [Q3KP44-1]
RefSeqiNP_078945.2. NM_024669.2. [Q3KP44-1]
UniGeneiHs.436214.

3D structure databases

ProteinModelPortaliQ3KP44.
SMRiQ3KP44. Positions 21-402.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122837. 11 interactions.
STRINGi9606.ENSP00000342295.

PTM databases

iPTMnetiQ3KP44.
PhosphoSiteiQ3KP44.

Polymorphism and mutation databases

BioMutaiANKRD55.
DMDMi408360322.

Proteomic databases

PaxDbiQ3KP44.
PeptideAtlasiQ3KP44.
PRIDEiQ3KP44.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341048; ENSP00000342295; ENSG00000164512. [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512. [Q3KP44-2]
GeneIDi79722.
KEGGihsa:79722.
UCSCiuc003jqt.4. human. [Q3KP44-1]

Organism-specific databases

CTDi79722.
GeneCardsiANKRD55.
HGNCiHGNC:25681. ANKRD55.
HPAiHPA051049.
MalaCardsiANKRD55.
MIMi615189. gene.
neXtProtiNX_Q3KP44.
Orphaneti85408. Juvenile rheumatoid factor-negative polyarthritis.
802. Multiple sclerosis.
85410. Oligoarticular juvenile arthritis.
PharmGKBiPA145149863.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129770.
HOGENOMiHOG000285984.
HOVERGENiHBG080859.
InParanoidiQ3KP44.
OMAiDQQKGDS.
OrthoDBiEOG7DNNTN.
PhylomeDBiQ3KP44.
TreeFamiTF315452.

Miscellaneous databases

GenomeRNAii79722.
PROiQ3KP44.
SOURCEiSearch...

Gene expression databases

BgeeiQ3KP44.
CleanExiHS_ANKRD55.
ExpressionAtlasiQ3KP44. baseline and differential.
GenevisibleiQ3KP44. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
[Graphical view]
SMARTiSM00248. ANK. 9 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Corpus callosum and Embryo.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-345.
  5. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Erythroleukemia.

Entry informationi

Entry nameiANR55_HUMAN
AccessioniPrimary (citable) accession number: Q3KP44
Secondary accession number(s): B3KVT8, Q3KP45, Q9HAD3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 3, 2012
Last modified: July 6, 2016
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.