Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-anchored junction protein

Gene

C11orf85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane.By similarity

Keywords - Biological processi

Meiosis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-anchored junction proteinBy similarity
Gene namesi
Name:C11orf85Imported
Synonyms:MAJINBy similarity
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:27441. C11orf85.

Subcellular locationi

  • Nucleus inner membrane By similarity; Single-pass membrane protein By similarity
  • Chromosometelomere By similarity

  • Note: In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 151151NuclearCuratedAdd
BLAST
Transmembranei152 – 17019HelicalSequence analysisAdd
BLAST
Topological domaini171 – 1766Perinuclear spaceCurated

Keywords - Cellular componenti

Chromosome, Membrane, Nucleus, Telomere

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162377786.

Polymorphism and mutation databases

BioMutaiC11orf85.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 176176Membrane-anchored junction proteinPRO_0000325832Add
BLAST

Proteomic databases

PaxDbiE9PPE5.
Q3KP22.
PRIDEiQ3KP22.

PTM databases

iPTMnetiQ3KP22.
PhosphoSiteiQ3KP22.

Expressioni

Gene expression databases

BgeeiQ3KP22.
CleanExiHS_C11orf85.
ExpressionAtlasiQ3KP22. baseline and differential.
GenevisibleiQ3KP22. HS.

Organism-specific databases

HPAiHPA039921.

Interactioni

Subunit structurei

Component of the MAJIN-TERB1-TERB2 complex, composed of MAJIN, TERB1 and TERB2.By similarity

Protein-protein interaction databases

BioGridi129469. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ3KP22.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MAJIN family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJYJ. Eukaryota.
ENOG410XTYT. LUCA.
GeneTreeiENSGT00390000007971.
HOGENOMiHOG000037935.
HOVERGENiHBG101163.
InParanoidiQ3KP22.
OMAiIXDSIRV.
PhylomeDBiQ3KP22.
TreeFamiTF336863.

Family and domain databases

InterProiIPR027816. DUF4544.
[Graphical view]
PfamiPF15077. DUF4544. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q3KP22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLKPFTYPF PETRFLHAGP NVYKFKIRYG KSIRGEEIEN KEVITQELEV
60 70 80 90 100
PVEKKAVGAV MRKRKHMDEP SSPSRPGLDR AKIGTSSQGP SKKKPPVETR
110 120 130 140 150
RNRERKTQQG LQETLASDIT DVQKQDSEWG HSLPGRIVPP LQHNSPPPKE
160 170
RAATGFFGFL SSLFPFRYFF RKSSHS
Length:176
Mass (Da):20,078
Last modified:January 20, 2016 - v2
Checksum:iEE818AC3BC07B190
GO
Isoform 1 (identifier: Q3KP22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: E → EDSVRVVLGN...KPISDSPLGL
     81-138: AKIGTSSQGP...WGHSLPGRIV → IGKEKPNKDC...SEQPPASLGF
     139-176: Missing.

Show »
Length:216
Mass (Da):24,809
Checksum:i293D4D14024BED42
GO
Isoform 2 (identifier: Q3KP22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELE → MKWFHENLSPGKPISDSPLGL

Show »
Length:148
Mass (Da):16,599
Checksum:i5EAA2F438C4FC312
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4949MSLKP…TQELE → MKWFHENLSPGKPISDSPLG L in isoform 2. VSP_058060Add
BLAST
Alternative sequencei49 – 491E → EDSVRVVLGNLDNLQPFATE HFIVFPYKSKWERVSHLKFK HGEIILIPYPFVFTLYVEMK WFHENLSPGKPISDSPLGL in isoform 1. VSP_058061
Alternative sequencei81 – 13858AKIGT…PGRIV → IGKEKPNKDCRRLWPLISLM SRNKILSGDTACQGELSHPC STTHLHLRSEQPPASLGF in isoform 1. VSP_058062Add
BLAST
Alternative sequencei139 – 17638Missing in isoform 1. VSP_058063Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093130 mRNA. Translation: BAG52661.1.
AP000436 Genomic DNA. No translation available.
AP001187 Genomic DNA. No translation available.
BC106951 mRNA. Translation: AAI06952.1.
BC106952 mRNA. Translation: AAI06953.1.
CCDSiCCDS31603.1. [Q3KP22-1]
RefSeqiNP_001032302.1. NM_001037225.2. [Q3KP22-1]
UniGeneiHs.567793.

Genome annotation databases

EnsembliENST00000301896; ENSP00000301896; ENSG00000168070. [Q3KP22-1]
ENST00000432175; ENSP00000395273; ENSG00000168070. [Q3KP22-1]
GeneIDi283129.
KEGGihsa:283129.
UCSCiuc001ocb.1. human. [Q3KP22-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093130 mRNA. Translation: BAG52661.1.
AP000436 Genomic DNA. No translation available.
AP001187 Genomic DNA. No translation available.
BC106951 mRNA. Translation: AAI06952.1.
BC106952 mRNA. Translation: AAI06953.1.
CCDSiCCDS31603.1. [Q3KP22-1]
RefSeqiNP_001032302.1. NM_001037225.2. [Q3KP22-1]
UniGeneiHs.567793.

3D structure databases

ProteinModelPortaliQ3KP22.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129469. 2 interactions.

PTM databases

iPTMnetiQ3KP22.
PhosphoSiteiQ3KP22.

Polymorphism and mutation databases

BioMutaiC11orf85.

Proteomic databases

PaxDbiE9PPE5.
Q3KP22.
PRIDEiQ3KP22.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301896; ENSP00000301896; ENSG00000168070. [Q3KP22-1]
ENST00000432175; ENSP00000395273; ENSG00000168070. [Q3KP22-1]
GeneIDi283129.
KEGGihsa:283129.
UCSCiuc001ocb.1. human. [Q3KP22-1]

Organism-specific databases

CTDi283129.
GeneCardsiC11orf85.
HGNCiHGNC:27441. C11orf85.
HPAiHPA039921.
neXtProtiNX_Q3KP22.
PharmGKBiPA162377786.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJYJ. Eukaryota.
ENOG410XTYT. LUCA.
GeneTreeiENSGT00390000007971.
HOGENOMiHOG000037935.
HOVERGENiHBG101163.
InParanoidiQ3KP22.
OMAiIXDSIRV.
PhylomeDBiQ3KP22.
TreeFamiTF336863.

Miscellaneous databases

GenomeRNAii283129.
NextBioi35469672.
PROiQ3KP22.

Gene expression databases

BgeeiQ3KP22.
CleanExiHS_C11orf85.
ExpressionAtlasiQ3KP22. baseline and differential.
GenevisibleiQ3KP22. HS.

Family and domain databases

InterProiIPR027816. DUF4544.
[Graphical view]
PfamiPF15077. DUF4544. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiMAJIN_HUMAN
AccessioniPrimary (citable) accession number: Q3KP22
Secondary accession number(s): B3KS99, E9PPE5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 20, 2016
Last modified: January 20, 2016
This is version 70 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.