Q3AI88RUVC_SYNSCCrossover junction endodeoxyribonuclease RuvC3.1.21.10Holliday junction nuclease RuvCHolliday junction resolvase RuvCruvCSyncc9605_1953Synechococcus sp. (strain CC9605)BacteriaCyanobacteriotaCyanophyceaeSynechococcalesSynechococcaceaeSynechococcusComplete sequence of Synechococcus sp. CC9605.NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]The RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair. Endonuclease that resolves HJ intermediates. Cleaves cruciform DNA by making single-stranded nicks across the HJ at symmetrical positions within the homologous arms, yielding a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction. The consensus cleavage sequence is 5'-(A/T)TT(C/G)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange. HJ branch migration catalyzed by RuvA-RuvB allows RuvC to scan DNA until it finds its consensus sequence, where it cleaves and resolves the cruciform DNA.Endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (Holliday junction).Mg(2+)Binds 2 Mg(2+) ion per subunit.Homodimer which binds Holliday junction (HJ) DNA. The HJ becomes 2-fold symmetrical on binding to RuvC with unstacked arms; it has a different conformation from HJ DNA in complex with RuvA. In the full resolvosome a probable DNA-RuvA(4)-RuvB(12)-RuvC(2) complex forms which resolves the HJ.CytoplasmBelongs to the RuvC family.CytoplasmDNA damageDNA recombinationDNA repairDNA-bindingEndonucleaseHydrolaseMagnesiumMetal-bindingNucleaseMg(2+)Mg(2+)Mg(2+)MRILGIDPGLARVGYGVIDIQDGCQRMLDCGIIQTNSDRSDGDRMVEIAGDLRQLIRIWRPELAAVEKFFFYRSSNTINVVQARGVVVMTLARFKIPMVEFPPMQIKLAVAGFGHAEKDEVLEAVMRELSLEEPPRPDDAADALAVALTAWLQR
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License