Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q33E94

- RFX4_HUMAN

UniProt

Q33E94 - RFX4_HUMAN

Protein

Transcription factor RFX4

Gene

RFX4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May activate transcription by interacting directly with the X-box.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi44 – 12683Add
    BLAST
    DNA bindingi61 – 13676RFX-type winged-helixPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. chromatin binding Source: Ensembl
    2. DNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. cerebellar cortex morphogenesis Source: Ensembl
    2. dorsal spinal cord development Source: Ensembl
    3. forebrain development Source: Ensembl
    4. midbrain development Source: Ensembl
    5. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    6. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcription factor RFX4
    Alternative name(s):
    Regulatory factor X 4
    Testis development protein NYD-SP10
    Gene namesi
    Name:RFX4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:9985. RFX4.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34355.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 735735Transcription factor RFX4PRO_0000314237Add
    BLAST

    Proteomic databases

    PaxDbiQ33E94.
    PRIDEiQ33E94.

    PTM databases

    PhosphoSiteiQ33E94.

    Expressioni

    Tissue specificityi

    Isoform 4 is testis-specific. Isoform 1 is expressed in brain and gliomas. Isoform 2 and isoform 3 are testis-specific (at protein level). Isoform 1 is expressed in brain (at protein level). Isoform 3 is expressed at a higher level in adult testes and ejaculated spematozoa than in fetal testes.3 Publications

    Gene expression databases

    ArrayExpressiQ33E94.
    BgeeiQ33E94.
    GenevestigatoriQ33E94.

    Organism-specific databases

    HPAiHPA050527.

    Interactioni

    Subunit structurei

    Homodimer. Heterodimer with RFX2 and RFX3. Binds DNA.

    Protein-protein interaction databases

    BioGridi111924. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ33E94.
    SMRiQ33E94. Positions 61-135.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni315 – 487173Necessary for dimerizationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the RFX family.PROSITE-ProRule annotation
    Contains 1 RFX-type winged-helix DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG243313.
    HOVERGENiHBG101271.
    KOiK09174.
    OMAiGAMQSYT.
    OrthoDBiEOG79CXXT.
    TreeFamiTF321340.

    Family and domain databases

    Gene3Di1.10.10.10. 1 hit.
    InterProiIPR003150. DNA-bd_RFX.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view]
    PfamiPF02257. RFX_DNA_binding. 1 hit.
    [Graphical view]
    PROSITEiPS51526. RFX_DBD. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q33E94-1) [UniParc]FASTAAdd to Basket

    Also known as: RFX4-D, RFX4_v3

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHCGLLEEPD MDSTESWIER CLNESENKRY SSHTSLGNVS NDENEEKENN    50
    RASKPHSTPA TLQWLEENYE IAEGVCIPRS ALYMHYLDFC EKNDTQPVNA 100
    ASFGKIIRQQ FPQLTTRRLG TRGQSKYHYY GIAVKESSQY YDVMYSKKGA 150
    AWVSETGKKE VSKQTVAYSP RSKLGTLLPE FPNVKDLNLP ASLPEEKVST 200
    FIMMYRTHCQ RILDTVIRAN FDEVQSFLLH FWQGMPPHML PVLGSSTVVN 250
    IVGVCDSILY KAISGVLMPT VLQALPDSLT QVIRKFAKQL DEWLKVALHD 300
    LPENLRNIKF ELSRRFSQIL RRQTSLNHLC QASRTVIHSA DITFQMLEDW 350
    RNVDLNSITK QTLYTMEDSR DEHRKLITQL YQEFDHLLEE QSPIESYIEW 400
    LDTMVDRCVV KVAAKRQGSL KKVAQQFLLM WSCFGTRVIR DMTLHSAPSF 450
    GSFHLIHLMF DDYVLYLLES LHCQERANEL MRAMKGEGST AEVREEIILT 500
    EAAAPTPSPV PSFSPAKSAT SVEVPPPSSP VSNPSPEYTG LSTTGAMQSY 550
    TWSLTYTVTT AAGSPAENSQ QLPCMRNTHV PSSSVTHRIP VYPHREEHGY 600
    TGSYNYGSYG NQHPHPMQSQ YPALPHDTAI SGPLHYAPYH RSSAQYPFNS 650
    PTSRMEPCLM SSTPRLHPTP VTPRWPEVPS ANTCYTSPSV HSARYGNSSD 700
    MYTPLTTRRN SEYEHMQHFP GFAYINGEAS TGWAK 735
    Length:735
    Mass (Da):83,368
    Last modified:May 3, 2011 - v2
    Checksum:i9C2422428B9D7E8B
    GO
    Isoform 2 (identifier: Q33E94-2) [UniParc]FASTAAdd to Basket

    Also known as: RFX4-C, RFX4_v4

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MHCGLLEEPDMD → MIKRRAHPGAGGDRTRPRRRR

    Show »
    Length:744
    Mass (Da):84,479
    Checksum:i5A36FF5CB5D8EFB7
    GO
    Isoform 3 (identifier: Q33E94-3) [UniParc]FASTAAdd to Basket

    Also known as: RFX4-A, RFX4_v1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-94: Missing.
         95-126: TQPVNAASFGKIIRQQFPQLTTRRLGTRGQSK → MNWAAFGGSEFFIPEGIQIDSRCPLSRNITEW

    Show »
    Length:641
    Mass (Da):72,561
    Checksum:i55FD9787E6771AF8
    GO
    Isoform 4 (identifier: Q33E94-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MHCGLLEEPDMD → MIKRRAHPGAGGDRTRPRRRR
         546-554: AMQSYTWSL → NGKSFKNFG
         555-735: Missing.

    Show »
    Length:563
    Mass (Da):64,181
    Checksum:i67D9817BB0BC6B9E
    GO

    Sequence cautioni

    The sequence BAB59001.1 differs from that shown. Reason: Probable intron retention.
    The sequence BAC11288.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAE48237.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAE48238.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti417 – 4171Q → R in AAK17191. (PubMed:16193984)Curated
    Sequence conflicti423 – 4231V → E in BAC11288. (PubMed:14702039)Curated
    Sequence conflicti477 – 4771A → T in AAH28582. (PubMed:15489334)Curated
    Sequence conflicti522 – 5221V → M in AAM52484. (PubMed:12925582)Curated
    Sequence conflicti549 – 5491S → A in BAE48231. (PubMed:16271074)Curated
    Sequence conflicti549 – 5491S → A in BAE48237. (PubMed:16271074)Curated
    Sequence conflicti549 – 5491S → A in BAE48238. (PubMed:16271074)Curated
    Sequence conflicti549 – 5491S → A in AAK17191. (PubMed:16193984)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti687 – 6871S → N.2 Publications
    VAR_037873
    Natural varianti698 – 6981S → A.
    Corresponds to variant rs17038766 [ dbSNP | Ensembl ].
    VAR_057152

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9494Missing in isoform 3. 3 PublicationsVSP_030242Add
    BLAST
    Alternative sequencei1 – 1212MHCGL…EPDMD → MIKRRAHPGAGGDRTRPRRR R in isoform 2 and isoform 4. 2 PublicationsVSP_030243Add
    BLAST
    Alternative sequencei95 – 12632TQPVN…RGQSK → MNWAAFGGSEFFIPEGIQID SRCPLSRNITEW in isoform 3. 3 PublicationsVSP_030244Add
    BLAST
    Alternative sequencei546 – 5549AMQSYTWSL → NGKSFKNFG in isoform 4. 1 PublicationVSP_030245
    Alternative sequencei555 – 735181Missing in isoform 4. 1 PublicationVSP_030246Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY102009 mRNA. Translation: AAM52484.1.
    AB095365 mRNA. Translation: BAE48231.1.
    AB095366 mRNA. Translation: BAE48232.1.
    AB195784 mRNA. Translation: BAE48237.1. Different initiation.
    AB195785 mRNA. Translation: BAE48238.1. Different initiation.
    AF332192 mRNA. Translation: AAK17191.1.
    AK074913 mRNA. Translation: BAC11288.1. Different initiation.
    AK291445 mRNA. Translation: BAF84134.1.
    AK315698 mRNA. Translation: BAG38061.1.
    AC009721 Genomic DNA. No translation available.
    AC079385 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97783.1.
    CH471054 Genomic DNA. Translation: EAW97784.1.
    CH471054 Genomic DNA. Translation: EAW97782.1.
    BC028582 mRNA. Translation: AAH28582.1.
    BC030644 mRNA. Translation: AAH30644.1.
    AB044245 mRNA. Translation: BAB59001.1. Sequence problems.
    AL833921 mRNA. Translation: CAD38777.1.
    CCDSiCCDS55880.1. [Q33E94-2]
    CCDS9106.1. [Q33E94-1]
    CCDS9108.1. [Q33E94-3]
    RefSeqiNP_001193620.1. NM_001206691.1. [Q33E94-2]
    NP_115880.2. NM_032491.5. [Q33E94-3]
    NP_998759.1. NM_213594.2. [Q33E94-1]
    UniGeneiHs.388827.

    Genome annotation databases

    EnsembliENST00000229387; ENSP00000229387; ENSG00000111783. [Q33E94-3]
    ENST00000357881; ENSP00000350552; ENSG00000111783. [Q33E94-2]
    ENST00000392842; ENSP00000376585; ENSG00000111783. [Q33E94-1]
    GeneIDi5992.
    KEGGihsa:5992.
    UCSCiuc001tlr.3. human. [Q33E94-1]
    uc001tls.3. human. [Q33E94-4]
    uc001tlt.3. human. [Q33E94-2]
    uc001tlv.3. human. [Q33E94-3]

    Polymorphism databases

    DMDMi332278145.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY102009 mRNA. Translation: AAM52484.1 .
    AB095365 mRNA. Translation: BAE48231.1 .
    AB095366 mRNA. Translation: BAE48232.1 .
    AB195784 mRNA. Translation: BAE48237.1 . Different initiation.
    AB195785 mRNA. Translation: BAE48238.1 . Different initiation.
    AF332192 mRNA. Translation: AAK17191.1 .
    AK074913 mRNA. Translation: BAC11288.1 . Different initiation.
    AK291445 mRNA. Translation: BAF84134.1 .
    AK315698 mRNA. Translation: BAG38061.1 .
    AC009721 Genomic DNA. No translation available.
    AC079385 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97783.1 .
    CH471054 Genomic DNA. Translation: EAW97784.1 .
    CH471054 Genomic DNA. Translation: EAW97782.1 .
    BC028582 mRNA. Translation: AAH28582.1 .
    BC030644 mRNA. Translation: AAH30644.1 .
    AB044245 mRNA. Translation: BAB59001.1 . Sequence problems.
    AL833921 mRNA. Translation: CAD38777.1 .
    CCDSi CCDS55880.1. [Q33E94-2 ]
    CCDS9106.1. [Q33E94-1 ]
    CCDS9108.1. [Q33E94-3 ]
    RefSeqi NP_001193620.1. NM_001206691.1. [Q33E94-2 ]
    NP_115880.2. NM_032491.5. [Q33E94-3 ]
    NP_998759.1. NM_213594.2. [Q33E94-1 ]
    UniGenei Hs.388827.

    3D structure databases

    ProteinModelPortali Q33E94.
    SMRi Q33E94. Positions 61-135.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111924. 3 interactions.

    PTM databases

    PhosphoSitei Q33E94.

    Polymorphism databases

    DMDMi 332278145.

    Proteomic databases

    PaxDbi Q33E94.
    PRIDEi Q33E94.

    Protocols and materials databases

    DNASUi 5992.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000229387 ; ENSP00000229387 ; ENSG00000111783 . [Q33E94-3 ]
    ENST00000357881 ; ENSP00000350552 ; ENSG00000111783 . [Q33E94-2 ]
    ENST00000392842 ; ENSP00000376585 ; ENSG00000111783 . [Q33E94-1 ]
    GeneIDi 5992.
    KEGGi hsa:5992.
    UCSCi uc001tlr.3. human. [Q33E94-1 ]
    uc001tls.3. human. [Q33E94-4 ]
    uc001tlt.3. human. [Q33E94-2 ]
    uc001tlv.3. human. [Q33E94-3 ]

    Organism-specific databases

    CTDi 5992.
    GeneCardsi GC12P106976.
    H-InvDB HIX0037058.
    HGNCi HGNC:9985. RFX4.
    HPAi HPA050527.
    MIMi 603958. gene.
    neXtProti NX_Q33E94.
    PharmGKBi PA34355.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG243313.
    HOVERGENi HBG101271.
    KOi K09174.
    OMAi GAMQSYT.
    OrthoDBi EOG79CXXT.
    TreeFami TF321340.

    Miscellaneous databases

    GeneWikii RFX4.
    GenomeRNAii 5992.
    NextBioi 23341.
    PROi Q33E94.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q33E94.
    Bgeei Q33E94.
    Genevestigatori Q33E94.

    Family and domain databases

    Gene3Di 1.10.10.10. 1 hit.
    InterProi IPR003150. DNA-bd_RFX.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view ]
    Pfami PF02257. RFX_DNA_binding. 1 hit.
    [Graphical view ]
    PROSITEi PS51526. RFX_DBD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Graded phenotypic response to partial and complete deficiency of a brain-specific transcript variant of the winged helix transcription factor RFX4."
      Blackshear P.J., Graves J.P., Stumpo D.J., Cobos I., Rubenstein J.L.R., Zeldin D.C.
      Development 130:4539-4552(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Identification of glioma-specific RFX4-E and -F isoforms and humoral immune response in patients."
      Matsushita H., Uenaka A., Ono T., Hasegawa K., Sato S., Koizumi F., Nakagawa K., Toda M., Shingo T., Ichikawa T., Noguchi Y., Tamiya T., Furuta T., Kawase T., Date I., Nakayama E.
      Cancer Sci. 96:801-809(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANT ASN-687.
      Tissue: Astrocytoma and Testis.
    3. "Identification of a novel substrate for tyrosine kinase in human testes."
      Huang X., Zhou Z., Yin L., Zhu H., Wang L., Lin M., Zhou Y., Sha J.
      J. Nanosci. Nanotechnol. 5:1236-1239(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, VARIANT ASN-687.
      Tissue: Testis.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain and Testis.
    5. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    8. "Human regulatory factor X 4 (RFX4) is a testis-specific dimeric DNA-binding protein that cooperates with other human RFX members."
      Morotomi-Yano K., Yano K., Saito H., Sun Z., Iwama A., Miki Y.
      J. Biol. Chem. 277:836-842(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-545 (ISOFORM 4), TISSUE SPECIFICITY, INTERACTION WITH RFX2 AND RFX3.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 256-735 (ISOFORM 1).
      Tissue: Testis.

    Entry informationi

    Entry nameiRFX4_HUMAN
    AccessioniPrimary (citable) accession number: Q33E94
    Secondary accession number(s): A8K5Y0
    , B2RDW4, Q33DW6, Q33DW7, Q33E95, Q6YM53, Q8MHQ1, Q8NC78, Q8NDF9, Q8SNA1, Q96S80, Q9BXI0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3