Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q33E94

- RFX4_HUMAN

UniProt

Q33E94 - RFX4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor RFX4

Gene

RFX4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May activate transcription by interacting directly with the X-box.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi44 – 12683Add
BLAST
DNA bindingi61 – 13676RFX-type winged-helixPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. chromatin binding Source: Ensembl
  2. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. cerebellar cortex morphogenesis Source: Ensembl
  2. cilium assembly Source: Ensembl
  3. dorsal spinal cord development Source: Ensembl
  4. midbrain development Source: Ensembl
  5. negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning Source: Ensembl
  6. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  7. regulation of protein processing Source: Ensembl
  8. telencephalon development Source: Ensembl
  9. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor RFX4
Alternative name(s):
Regulatory factor X 4
Testis development protein NYD-SP10
Gene namesi
Name:RFX4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:9985. RFX4.

Subcellular locationi

Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34355.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 735735Transcription factor RFX4PRO_0000314237Add
BLAST

Proteomic databases

PaxDbiQ33E94.
PRIDEiQ33E94.

PTM databases

PhosphoSiteiQ33E94.

Expressioni

Tissue specificityi

Isoform 4 is testis-specific. Isoform 1 is expressed in brain and gliomas. Isoform 2 and isoform 3 are testis-specific (at protein level). Isoform 1 is expressed in brain (at protein level). Isoform 3 is expressed at a higher level in adult testes and ejaculated spematozoa than in fetal testes.3 Publications

Gene expression databases

BgeeiQ33E94.
ExpressionAtlasiQ33E94. baseline and differential.
GenevestigatoriQ33E94.

Organism-specific databases

HPAiHPA050527.

Interactioni

Subunit structurei

Homodimer. Heterodimer with RFX2 and RFX3. Binds DNA.

Binary interactionsi

WithEntry#Exp.IntActNotes
P140793EBI-9675925,EBI-9675698From a different organism.

Protein-protein interaction databases

BioGridi111924. 3 interactions.
IntActiQ33E94. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ33E94.
SMRiQ33E94. Positions 61-135.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni315 – 487173Necessary for dimerizationAdd
BLAST

Sequence similaritiesi

Belongs to the RFX family.PROSITE-ProRule annotation
Contains 1 RFX-type winged-helix DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG243313.
GeneTreeiENSGT00550000074532.
HOVERGENiHBG101271.
InParanoidiQ33E94.
KOiK09174.
OMAiGAMQSYT.
OrthoDBiEOG79CXXT.
TreeFamiTF321340.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR003150. DNA-bd_RFX.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF02257. RFX_DNA_binding. 1 hit.
[Graphical view]
PROSITEiPS51526. RFX_DBD. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q33E94-1) [UniParc]FASTAAdd to Basket

Also known as: RFX4-D, RFX4_v3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHCGLLEEPD MDSTESWIER CLNESENKRY SSHTSLGNVS NDENEEKENN
60 70 80 90 100
RASKPHSTPA TLQWLEENYE IAEGVCIPRS ALYMHYLDFC EKNDTQPVNA
110 120 130 140 150
ASFGKIIRQQ FPQLTTRRLG TRGQSKYHYY GIAVKESSQY YDVMYSKKGA
160 170 180 190 200
AWVSETGKKE VSKQTVAYSP RSKLGTLLPE FPNVKDLNLP ASLPEEKVST
210 220 230 240 250
FIMMYRTHCQ RILDTVIRAN FDEVQSFLLH FWQGMPPHML PVLGSSTVVN
260 270 280 290 300
IVGVCDSILY KAISGVLMPT VLQALPDSLT QVIRKFAKQL DEWLKVALHD
310 320 330 340 350
LPENLRNIKF ELSRRFSQIL RRQTSLNHLC QASRTVIHSA DITFQMLEDW
360 370 380 390 400
RNVDLNSITK QTLYTMEDSR DEHRKLITQL YQEFDHLLEE QSPIESYIEW
410 420 430 440 450
LDTMVDRCVV KVAAKRQGSL KKVAQQFLLM WSCFGTRVIR DMTLHSAPSF
460 470 480 490 500
GSFHLIHLMF DDYVLYLLES LHCQERANEL MRAMKGEGST AEVREEIILT
510 520 530 540 550
EAAAPTPSPV PSFSPAKSAT SVEVPPPSSP VSNPSPEYTG LSTTGAMQSY
560 570 580 590 600
TWSLTYTVTT AAGSPAENSQ QLPCMRNTHV PSSSVTHRIP VYPHREEHGY
610 620 630 640 650
TGSYNYGSYG NQHPHPMQSQ YPALPHDTAI SGPLHYAPYH RSSAQYPFNS
660 670 680 690 700
PTSRMEPCLM SSTPRLHPTP VTPRWPEVPS ANTCYTSPSV HSARYGNSSD
710 720 730
MYTPLTTRRN SEYEHMQHFP GFAYINGEAS TGWAK
Length:735
Mass (Da):83,368
Last modified:May 3, 2011 - v2
Checksum:i9C2422428B9D7E8B
GO
Isoform 2 (identifier: Q33E94-2) [UniParc]FASTAAdd to Basket

Also known as: RFX4-C, RFX4_v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MHCGLLEEPDMD → MIKRRAHPGAGGDRTRPRRRR

Show »
Length:744
Mass (Da):84,479
Checksum:i5A36FF5CB5D8EFB7
GO
Isoform 3 (identifier: Q33E94-3) [UniParc]FASTAAdd to Basket

Also known as: RFX4-A, RFX4_v1

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.
     95-126: TQPVNAASFGKIIRQQFPQLTTRRLGTRGQSK → MNWAAFGGSEFFIPEGIQIDSRCPLSRNITEW

Show »
Length:641
Mass (Da):72,561
Checksum:i55FD9787E6771AF8
GO
Isoform 4 (identifier: Q33E94-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MHCGLLEEPDMD → MIKRRAHPGAGGDRTRPRRRR
     546-554: AMQSYTWSL → NGKSFKNFG
     555-735: Missing.

Show »
Length:563
Mass (Da):64,181
Checksum:i67D9817BB0BC6B9E
GO

Sequence cautioni

The sequence BAB59001.1 differs from that shown. Reason: Probable intron retention.
The sequence BAC11288.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAE48237.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAE48238.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti417 – 4171Q → R in AAK17191. (PubMed:16193984)Curated
Sequence conflicti423 – 4231V → E in BAC11288. (PubMed:14702039)Curated
Sequence conflicti477 – 4771A → T in AAH28582. (PubMed:15489334)Curated
Sequence conflicti522 – 5221V → M in AAM52484. (PubMed:12925582)Curated
Sequence conflicti549 – 5491S → A in BAE48231. (PubMed:16271074)Curated
Sequence conflicti549 – 5491S → A in BAE48237. (PubMed:16271074)Curated
Sequence conflicti549 – 5491S → A in BAE48238. (PubMed:16271074)Curated
Sequence conflicti549 – 5491S → A in AAK17191. (PubMed:16193984)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti687 – 6871S → N.2 Publications
VAR_037873
Natural varianti698 – 6981S → A.
Corresponds to variant rs17038766 [ dbSNP | Ensembl ].
VAR_057152

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9494Missing in isoform 3. 3 PublicationsVSP_030242Add
BLAST
Alternative sequencei1 – 1212MHCGL…EPDMD → MIKRRAHPGAGGDRTRPRRR R in isoform 2 and isoform 4. 2 PublicationsVSP_030243Add
BLAST
Alternative sequencei95 – 12632TQPVN…RGQSK → MNWAAFGGSEFFIPEGIQID SRCPLSRNITEW in isoform 3. 3 PublicationsVSP_030244Add
BLAST
Alternative sequencei546 – 5549AMQSYTWSL → NGKSFKNFG in isoform 4. 1 PublicationVSP_030245
Alternative sequencei555 – 735181Missing in isoform 4. 1 PublicationVSP_030246Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY102009 mRNA. Translation: AAM52484.1.
AB095365 mRNA. Translation: BAE48231.1.
AB095366 mRNA. Translation: BAE48232.1.
AB195784 mRNA. Translation: BAE48237.1. Different initiation.
AB195785 mRNA. Translation: BAE48238.1. Different initiation.
AF332192 mRNA. Translation: AAK17191.1.
AK074913 mRNA. Translation: BAC11288.1. Different initiation.
AK291445 mRNA. Translation: BAF84134.1.
AK315698 mRNA. Translation: BAG38061.1.
AC009721 Genomic DNA. No translation available.
AC079385 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97783.1.
CH471054 Genomic DNA. Translation: EAW97784.1.
CH471054 Genomic DNA. Translation: EAW97782.1.
BC028582 mRNA. Translation: AAH28582.1.
BC030644 mRNA. Translation: AAH30644.1.
AB044245 mRNA. Translation: BAB59001.1. Sequence problems.
AL833921 mRNA. Translation: CAD38777.1.
CCDSiCCDS55880.1. [Q33E94-2]
CCDS9106.1. [Q33E94-1]
CCDS9108.1. [Q33E94-3]
RefSeqiNP_001193620.1. NM_001206691.1. [Q33E94-2]
NP_115880.2. NM_032491.5. [Q33E94-3]
NP_998759.1. NM_213594.2. [Q33E94-1]
UniGeneiHs.388827.

Genome annotation databases

EnsembliENST00000229387; ENSP00000229387; ENSG00000111783. [Q33E94-3]
ENST00000357881; ENSP00000350552; ENSG00000111783. [Q33E94-2]
ENST00000392842; ENSP00000376585; ENSG00000111783. [Q33E94-1]
GeneIDi5992.
KEGGihsa:5992.
UCSCiuc001tlr.3. human. [Q33E94-1]
uc001tls.3. human. [Q33E94-4]
uc001tlt.3. human. [Q33E94-2]
uc001tlv.3. human. [Q33E94-3]

Polymorphism databases

DMDMi332278145.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY102009 mRNA. Translation: AAM52484.1 .
AB095365 mRNA. Translation: BAE48231.1 .
AB095366 mRNA. Translation: BAE48232.1 .
AB195784 mRNA. Translation: BAE48237.1 . Different initiation.
AB195785 mRNA. Translation: BAE48238.1 . Different initiation.
AF332192 mRNA. Translation: AAK17191.1 .
AK074913 mRNA. Translation: BAC11288.1 . Different initiation.
AK291445 mRNA. Translation: BAF84134.1 .
AK315698 mRNA. Translation: BAG38061.1 .
AC009721 Genomic DNA. No translation available.
AC079385 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97783.1 .
CH471054 Genomic DNA. Translation: EAW97784.1 .
CH471054 Genomic DNA. Translation: EAW97782.1 .
BC028582 mRNA. Translation: AAH28582.1 .
BC030644 mRNA. Translation: AAH30644.1 .
AB044245 mRNA. Translation: BAB59001.1 . Sequence problems.
AL833921 mRNA. Translation: CAD38777.1 .
CCDSi CCDS55880.1. [Q33E94-2 ]
CCDS9106.1. [Q33E94-1 ]
CCDS9108.1. [Q33E94-3 ]
RefSeqi NP_001193620.1. NM_001206691.1. [Q33E94-2 ]
NP_115880.2. NM_032491.5. [Q33E94-3 ]
NP_998759.1. NM_213594.2. [Q33E94-1 ]
UniGenei Hs.388827.

3D structure databases

ProteinModelPortali Q33E94.
SMRi Q33E94. Positions 61-135.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111924. 3 interactions.
IntActi Q33E94. 1 interaction.

PTM databases

PhosphoSitei Q33E94.

Polymorphism databases

DMDMi 332278145.

Proteomic databases

PaxDbi Q33E94.
PRIDEi Q33E94.

Protocols and materials databases

DNASUi 5992.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000229387 ; ENSP00000229387 ; ENSG00000111783 . [Q33E94-3 ]
ENST00000357881 ; ENSP00000350552 ; ENSG00000111783 . [Q33E94-2 ]
ENST00000392842 ; ENSP00000376585 ; ENSG00000111783 . [Q33E94-1 ]
GeneIDi 5992.
KEGGi hsa:5992.
UCSCi uc001tlr.3. human. [Q33E94-1 ]
uc001tls.3. human. [Q33E94-4 ]
uc001tlt.3. human. [Q33E94-2 ]
uc001tlv.3. human. [Q33E94-3 ]

Organism-specific databases

CTDi 5992.
GeneCardsi GC12P106976.
H-InvDB HIX0037058.
HGNCi HGNC:9985. RFX4.
HPAi HPA050527.
MIMi 603958. gene.
neXtProti NX_Q33E94.
PharmGKBi PA34355.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG243313.
GeneTreei ENSGT00550000074532.
HOVERGENi HBG101271.
InParanoidi Q33E94.
KOi K09174.
OMAi GAMQSYT.
OrthoDBi EOG79CXXT.
TreeFami TF321340.

Miscellaneous databases

GeneWikii RFX4.
GenomeRNAii 5992.
NextBioi 23341.
PROi Q33E94.
SOURCEi Search...

Gene expression databases

Bgeei Q33E94.
ExpressionAtlasi Q33E94. baseline and differential.
Genevestigatori Q33E94.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR003150. DNA-bd_RFX.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
Pfami PF02257. RFX_DNA_binding. 1 hit.
[Graphical view ]
PROSITEi PS51526. RFX_DBD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Graded phenotypic response to partial and complete deficiency of a brain-specific transcript variant of the winged helix transcription factor RFX4."
    Blackshear P.J., Graves J.P., Stumpo D.J., Cobos I., Rubenstein J.L.R., Zeldin D.C.
    Development 130:4539-4552(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Identification of glioma-specific RFX4-E and -F isoforms and humoral immune response in patients."
    Matsushita H., Uenaka A., Ono T., Hasegawa K., Sato S., Koizumi F., Nakagawa K., Toda M., Shingo T., Ichikawa T., Noguchi Y., Tamiya T., Furuta T., Kawase T., Date I., Nakayama E.
    Cancer Sci. 96:801-809(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANT ASN-687.
    Tissue: Astrocytoma and Testis.
  3. "Identification of a novel substrate for tyrosine kinase in human testes."
    Huang X., Zhou Z., Yin L., Zhu H., Wang L., Lin M., Zhou Y., Sha J.
    J. Nanosci. Nanotechnol. 5:1236-1239(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, VARIANT ASN-687.
    Tissue: Testis.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain and Testis.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  8. "Human regulatory factor X 4 (RFX4) is a testis-specific dimeric DNA-binding protein that cooperates with other human RFX members."
    Morotomi-Yano K., Yano K., Saito H., Sun Z., Iwama A., Miki Y.
    J. Biol. Chem. 277:836-842(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-545 (ISOFORM 4), TISSUE SPECIFICITY, INTERACTION WITH RFX2 AND RFX3.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 256-735 (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiRFX4_HUMAN
AccessioniPrimary (citable) accession number: Q33E94
Secondary accession number(s): A8K5Y0
, B2RDW4, Q33DW6, Q33DW7, Q33E95, Q6YM53, Q8MHQ1, Q8NC78, Q8NDF9, Q8SNA1, Q96S80, Q9BXI0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 3, 2011
Last modified: October 29, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3