Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat flightless-interacting protein 1

Gene

LRRFIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA. Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding.5 Publications

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • DNA binding Source: UniProtKB
  • double-stranded RNA binding Source: ProtInc
  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-1839117. Signaling by cytosolic FGFR1 fusion mutants.
R-HSA-3134973. LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production.
R-HSA-5655302. Signaling by FGFR1 in disease.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat flightless-interacting protein 1
Short name:
LRR FLII-interacting protein 1
Alternative name(s):
GC-binding factor 2
TAR RNA-interacting protein
Gene namesi
Name:LRRFIP1
Synonyms:GCF2, TRIP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:6702. LRRFIP1.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • cytoplasm Source: HPA
  • cytoskeleton Source: ProtInc
  • cytosol Source: Reactome
  • nucleus Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9208.
OpenTargetsiENSG00000124831.
PharmGKBiPA30465.

Polymorphism and mutation databases

BioMutaiLRRFIP1.
DMDMi114149995.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002483922 – 808Leucine-rich repeat flightless-interacting protein 1Add BLAST807

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1
Modified residuei16PhosphoserineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei116PhosphoserineCombined sources1
Modified residuei120PhosphoserineCombined sources1
Modified residuei124PhosphoserineBy similarity1
Cross-linki305Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei555PhosphoserineCombined sources1
Modified residuei564PhosphoserineBy similarity1
Modified residuei581PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei638PhosphoserineBy similarity1
Modified residuei676PhosphothreonineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1
Modified residuei766PhosphoserineCombined sources1
Modified residuei768PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ32MZ4.
MaxQBiQ32MZ4.
PaxDbiQ32MZ4.
PeptideAtlasiQ32MZ4.
PRIDEiQ32MZ4.

PTM databases

iPTMnetiQ32MZ4.
PhosphoSitePlusiQ32MZ4.
SwissPalmiQ32MZ4.

Expressioni

Tissue specificityi

Ubiquitously expressed.2 Publications

Developmental stagei

Widely expressed in fetal tissues.1 Publication

Gene expression databases

BgeeiENSG00000124831.
CleanExiHS_LRRFIP1.
ExpressionAtlasiQ32MZ4. baseline and differential.
GenevisibleiQ32MZ4. HS.

Organism-specific databases

HPAiHPA006979.

Interactioni

Subunit structurei

Homodimer. May also form higher oligomers. Interacts with FLII. Interacts with MYD88. Competes with FLII for MyD88-binding, even in the absence of LPS.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CEP44Q9C0F13EBI-10240044,EBI-744115
FLIIQ130452EBI-1369100,EBI-351549
MED4Q9NPJ63EBI-10240044,EBI-394607

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi114642. 36 interactors.
IntActiQ32MZ4. 13 interactors.
STRINGi9606.ENSP00000375857.

Structurei

Secondary structure

1808
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi171 – 242Combined sources72
Turni243 – 245Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H22X-ray2.89A/B/C/D162-249[»]
ProteinModelPortaliQ32MZ4.
SMRiQ32MZ4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni485 – 584DNA-bindingAdd BLAST100

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili128 – 2501 PublicationAdd BLAST123

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi567 – 593Lys-richAdd BLAST27

Domaini

The DNA-binding domain is intrinsically unstructured.1 Publication
The coiled coil mediates dimerization.1 Publication

Sequence similaritiesi

Belongs to the LRRFIP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2010. Eukaryota.
ENOG4111H1S. LUCA.
GeneTreeiENSGT00530000063564.
HOGENOMiHOG000113391.
HOVERGENiHBG081935.
InParanoidiQ32MZ4.
OMAiDCVDIEV.
OrthoDBiEOG091G0C5Y.
PhylomeDBiQ32MZ4.
TreeFamiTF314109.

Family and domain databases

InterProiIPR019139. LRRFIP1/2.
[Graphical view]
PANTHERiPTHR19212. PTHR19212. 1 hit.
PfamiPF09738. LRRFIP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q32MZ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSPAAAQSR EIDCLSPEAQ KLAEARLAAK RAARAEAREI RMKELERQQK
60 70 80 90 100
EEDSERYSRR SRRNTSASDE DERMSVGSRG SLRVEERPEK DFTEKGSRNM
110 120 130 140 150
PGLSAATLAS LGGTSSRRGS GDTSISIDTE ASIREIKELN ELKDQIQDVE
160 170 180 190 200
GKYMQGLKEM KDSLAEVEEK YKKAMVSNAQ LDNEKTNFMY QVDTLKDMLL
210 220 230 240 250
ELEEQLAESR RQYEEKNKEF EREKHAHSIL QFQFAEVKEA LKQREEMLEK
260 270 280 290 300
HGIILNSEIA TNGETSDTLN NVGYQGPTKM TKEELNALKS TGDGTLGRAS
310 320 330 340 350
EVEVKNEIVA NVGKREILHN TEKEQHTEDT VKDCVDIEVF PAGENTEDQK
360 370 380 390 400
SSEDTAPFLG TLAGATYEEQ VQSQILESSS LPENTVQVES NEVMGAPDDR
410 420 430 440 450
TRTPLEPSNC WSDLDGGNHT ENVGEAAVTQ VEEQAGTVAS CPLGHSDDTV
460 470 480 490 500
YHDDKCMVEV PQELETSTGH SLEKEFTNQE AAEPKEVPAH STEVGRDHNE
510 520 530 540 550
EEGEETGLRD EKPIKTEVPG SPAGTEGNCQ EATGPSTVDT QNEPLDMKEP
560 570 580 590 600
DEEKSDQQGE ALDSSQKKTK NKKKKNKKKK SPVPVETLKD VKKELTYQNT
610 620 630 640 650
DLSEIKEEEQ VKSTDRKSAV EAQNEVTENP KQKIAAESSE NVDCPENPKI
660 670 680 690 700
KLDGKLDQEG DDVQTAAEEV LADGDTLDFE DDTVQSSGPR AGGEELDEGV
710 720 730 740 750
AKDNAKIDGA TQSSPAEPKS EDADRCTLPE HESPSQDISD ACEAESTERC
760 770 780 790 800
EMSEHPSQTV RKALDSNSLE NDDLSAPGRE PGHFNPESRE DTRGGNEKGK

SKEDCTMS
Length:808
Mass (Da):89,253
Last modified:September 5, 2006 - v2
Checksum:i4E6140DF2471A7C9
GO
Isoform 2 (identifier: Q32MZ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-160: Missing.

Show »
Length:784
Mass (Da):86,404
Checksum:iDDB6D45C670DBE97
GO
Isoform 3 (identifier: Q32MZ4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-83: Missing.
     137-160: Missing.

Show »
Length:752
Mass (Da):82,689
Checksum:iF99016BC7CE54A60
GO
Isoform 4 (identifier: Q32MZ4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MTSPAAAQSREIDCLSPEAQKL → MDMGTQGSGRKRLPNRERLTAEDDALNQIARE
     51-51: E → EIYQVQKKYYGLDTKWGDIEQWM
     83-83: R → RSQPDLEYGG...RASSARASPV
     249-249: E → EEIRQLQQKQASSIREISDLQETIEWKDKKIGALERQKEFFDSVRSERDDLREEVVMLKEELK
     297-450: GRASEVEVKN...CPLGHSDDTV → DIRLKKLVDE...ANRSALLSQQ
     451-808: Missing.

Show »
Length:640
Mass (Da):73,060
Checksum:iE7B967AF138F79C3
GO

Sequence cautioni

The sequence AAH01385 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAY14672 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti17P → L in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti26R → W in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti125I → F in CAA11076 (PubMed:9671805).Curated1
Sequence conflicti327T → A in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti562L → F in AAI08915 (PubMed:15489334).Curated1
Sequence conflicti665T → P in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti684V → A in AAC32037 (PubMed:9705290).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03603768S → C in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_027291275Q → R.Corresponds to variant rs3213869dbSNPEnsembl.1
Natural variantiVAR_027292418N → S.Corresponds to variant rs2001301dbSNPEnsembl.1
Natural variantiVAR_027293609E → K.Corresponds to variant rs3739041dbSNPEnsembl.1
Natural variantiVAR_056111633K → E.Corresponds to variant rs3739041dbSNPEnsembl.1
Natural variantiVAR_027294645P → L.Corresponds to variant rs3739040dbSNPEnsembl.1
Natural variantiVAR_027295779R → G.Corresponds to variant rs3739039dbSNPEnsembl.1
Natural variantiVAR_027296783H → D.Corresponds to variant rs3739038dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0468091 – 22MTSPA…EAQKL → MDMGTQGSGRKRLPNRERLT AEDDALNQIARE in isoform 4. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_04681051E → EIYQVQKKYYGLDTKWGDIE QWM in isoform 4. 1 Publication1
Alternative sequenceiVSP_02026452 – 83Missing in isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_04681183R → RSQPDLEYGGPYAWTNGYDG ELYGSQSLNRRSGRPSCLYS AARPSGSYRASVLDEGSFGG TRRGSTSGSRAPSEYSGHLN SSSRASSRASSARASPV in isoform 4. 1 Publication1
Alternative sequenceiVSP_020265137 – 160Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST24
Alternative sequenceiVSP_046812249E → EEIRQLQQKQASSIREISDL QETIEWKDKKIGALERQKEF FDSVRSERDDLREEVVMLKE ELK in isoform 4. 1 Publication1
Alternative sequenceiVSP_046813297 – 450GRASE…SDDTV → DIRLKKLVDERECLLEQIKK LKGQLEERQKIGKLDNLRSE DDVLENGTDMHVMDLQRDAN RQISDLKFKLAKSEQEITAL EQNVIRLESQVSRYKSAAEN AEKIEDELKAEKRKLQRELR SALDKTEELEVSNGHLVKRL EKMKANRSALLSQQ in isoform 4. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_046814451 – 808Missing in isoform 4. 1 PublicationAdd BLAST358

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U69609 mRNA. Translation: AAC32037.1.
AJ223075 mRNA. Translation: CAA11076.1.
AC012076 Genomic DNA. Translation: AAY14672.1. Sequence problems.
AC096574 Genomic DNA. No translation available.
BC001385 mRNA. Translation: AAH01385.1. Sequence problems.
BC108913 mRNA. Translation: AAI08914.1.
BC108914 mRNA. Translation: AAI08915.1.
AF115510 mRNA. Translation: AAD41258.1.
CCDSiCCDS2521.1. [Q32MZ4-2]
CCDS46551.1. [Q32MZ4-4]
CCDS46552.1. [Q32MZ4-1]
CCDS46553.1. [Q32MZ4-3]
RefSeqiNP_001131022.1. NM_001137550.1. [Q32MZ4-4]
NP_001131024.1. NM_001137552.1. [Q32MZ4-1]
NP_001131025.1. NM_001137553.1. [Q32MZ4-3]
NP_004726.2. NM_004735.3. [Q32MZ4-2]
UniGeneiHs.471779.

Genome annotation databases

EnsembliENST00000244815; ENSP00000244815; ENSG00000124831. [Q32MZ4-2]
ENST00000289175; ENSP00000289175; ENSG00000124831. [Q32MZ4-3]
ENST00000308482; ENSP00000310109; ENSG00000124831. [Q32MZ4-4]
ENST00000392000; ENSP00000375857; ENSG00000124831. [Q32MZ4-1]
GeneIDi9208.
KEGGihsa:9208.
UCSCiuc002vxc.4. human. [Q32MZ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U69609 mRNA. Translation: AAC32037.1.
AJ223075 mRNA. Translation: CAA11076.1.
AC012076 Genomic DNA. Translation: AAY14672.1. Sequence problems.
AC096574 Genomic DNA. No translation available.
BC001385 mRNA. Translation: AAH01385.1. Sequence problems.
BC108913 mRNA. Translation: AAI08914.1.
BC108914 mRNA. Translation: AAI08915.1.
AF115510 mRNA. Translation: AAD41258.1.
CCDSiCCDS2521.1. [Q32MZ4-2]
CCDS46551.1. [Q32MZ4-4]
CCDS46552.1. [Q32MZ4-1]
CCDS46553.1. [Q32MZ4-3]
RefSeqiNP_001131022.1. NM_001137550.1. [Q32MZ4-4]
NP_001131024.1. NM_001137552.1. [Q32MZ4-1]
NP_001131025.1. NM_001137553.1. [Q32MZ4-3]
NP_004726.2. NM_004735.3. [Q32MZ4-2]
UniGeneiHs.471779.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H22X-ray2.89A/B/C/D162-249[»]
ProteinModelPortaliQ32MZ4.
SMRiQ32MZ4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114642. 36 interactors.
IntActiQ32MZ4. 13 interactors.
STRINGi9606.ENSP00000375857.

PTM databases

iPTMnetiQ32MZ4.
PhosphoSitePlusiQ32MZ4.
SwissPalmiQ32MZ4.

Polymorphism and mutation databases

BioMutaiLRRFIP1.
DMDMi114149995.

Proteomic databases

EPDiQ32MZ4.
MaxQBiQ32MZ4.
PaxDbiQ32MZ4.
PeptideAtlasiQ32MZ4.
PRIDEiQ32MZ4.

Protocols and materials databases

DNASUi9208.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244815; ENSP00000244815; ENSG00000124831. [Q32MZ4-2]
ENST00000289175; ENSP00000289175; ENSG00000124831. [Q32MZ4-3]
ENST00000308482; ENSP00000310109; ENSG00000124831. [Q32MZ4-4]
ENST00000392000; ENSP00000375857; ENSG00000124831. [Q32MZ4-1]
GeneIDi9208.
KEGGihsa:9208.
UCSCiuc002vxc.4. human. [Q32MZ4-1]

Organism-specific databases

CTDi9208.
DisGeNETi9208.
GeneCardsiLRRFIP1.
H-InvDBHIX0030126.
HGNCiHGNC:6702. LRRFIP1.
HPAiHPA006979.
MIMi603256. gene.
neXtProtiNX_Q32MZ4.
OpenTargetsiENSG00000124831.
PharmGKBiPA30465.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2010. Eukaryota.
ENOG4111H1S. LUCA.
GeneTreeiENSGT00530000063564.
HOGENOMiHOG000113391.
HOVERGENiHBG081935.
InParanoidiQ32MZ4.
OMAiDCVDIEV.
OrthoDBiEOG091G0C5Y.
PhylomeDBiQ32MZ4.
TreeFamiTF314109.

Enzyme and pathway databases

ReactomeiR-HSA-1839117. Signaling by cytosolic FGFR1 fusion mutants.
R-HSA-3134973. LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production.
R-HSA-5655302. Signaling by FGFR1 in disease.

Miscellaneous databases

ChiTaRSiLRRFIP1. human.
GeneWikiiLRRFIP1.
GenomeRNAii9208.
PROiQ32MZ4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124831.
CleanExiHS_LRRFIP1.
ExpressionAtlasiQ32MZ4. baseline and differential.
GenevisibleiQ32MZ4. HS.

Family and domain databases

InterProiIPR019139. LRRFIP1/2.
[Graphical view]
PANTHERiPTHR19212. PTHR19212. 1 hit.
PfamiPF09738. LRRFIP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLRRF1_HUMAN
AccessioniPrimary (citable) accession number: Q32MZ4
Secondary accession number(s): E9PGZ2
, O75766, O75799, Q32MZ5, Q53T49, Q6PKG2, Q9Y607
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: November 2, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.