Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q32M45

- ANO4_HUMAN

UniProt

Q32M45 - ANO4_HUMAN

Protein

Anoctamin-4

Gene

ANO4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 79 (01 Oct 2014)
      Sequence version 1 (06 Dec 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Does not exhibit calcium-activated chloride channel (CaCC) activity.By similarity

    GO - Molecular functioni

    1. intracellular calcium activated chloride channel activity Source: UniProt

    GO - Biological processi

    1. chloride transmembrane transport Source: GOC
    2. chloride transport Source: UniProt
    3. ion transmembrane transport Source: Reactome
    4. transmembrane transport Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_160189. Stimuli-sensing channels.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Anoctamin-4
    Alternative name(s):
    Transmembrane protein 16D
    Gene namesi
    Name:ANO4
    Synonyms:TMEM16D
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:23837. ANO4.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Shows an intracellular localization.By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. intracellular Source: UniProtKB
    3. plasma membrane Source: UniProt

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164715582.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 955955Anoctamin-4PRO_0000288650Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi105 – 1051N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ32M45.
    PRIDEiQ32M45.

    PTM databases

    PhosphoSiteiQ32M45.

    Expressioni

    Gene expression databases

    ArrayExpressiQ32M45.
    BgeeiQ32M45.
    CleanExiHS_ANO4.
    GenevestigatoriQ32M45.

    Organism-specific databases

    HPAiHPA053412.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000376705.

    Structurei

    3D structure databases

    ProteinModelPortaliQ32M45.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 352352ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini374 – 42451CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini446 – 50560ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini527 – 54721CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini569 – 59527ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini617 – 71599CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini737 – 76832ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini790 – 88596CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini907 – 95549ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei353 – 37321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei425 – 44521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei506 – 52621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei548 – 56821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei596 – 61621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei716 – 73621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei769 – 78921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei886 – 90621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi462 – 4676Poly-Glu

    Sequence similaritiesi

    Belongs to the anoctamin family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG320103.
    HOGENOMiHOG000006509.
    HOVERGENiHBG069519.
    OMAiCFPLHEG.
    PhylomeDBiQ32M45.
    TreeFamiTF314265.

    Family and domain databases

    InterProiIPR007632. Anoctamin.
    [Graphical view]
    PANTHERiPTHR12308. PTHR12308. 1 hit.
    PfamiPF04547. Anoctamin. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q32M45-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEASSSGITN GKTKVFHPEG GVDLQGYQLD MQILPDGPKS DVDFSEILNA    50
    IQEMAKDVNI LFDELEAVSS PCKDDDSLLH PGNLTSTSDD ASRLEAGGET 100
    VPERNKSNGL YFRDGKCRID YILVYRKSNP QTEKREVFER NIRAEGLQME 150
    KESSLINSDI IFVKLHAPWE VLGRYAEQMN VRMPFRRKIY YLPRRYKFMS 200
    RIDKQISRFR RWLPKKPMRL DKETLPDLEE NDCYTAPFSQ QRIHHFIIHN 250
    KETFFNNATR SRIVHHILQR IKYEEGKNKI GLNRLLTNGS YEAAFPLHEG 300
    SYRSKNSIRT HGAENHRHLL YECWASWGVW YKYQPLDLVR RYFGEKIGLY 350
    FAWLGWYTGM LFPAAFIGLF VFLYGVTTLD HSQVSKEVCQ ATDIIMCPVC 400
    DKYCPFMRLS DSCVYAKVTH LFDNGATVFF AVFMAVWATV FLEFWKRRRA 450
    VIAYDWDLID WEEEEEEIRP QFEAKYSKKE RMNPISGKPE PYQAFTDKCS 500
    RLIVSASGIF FMICVVIAAV FGIVIYRVVT VSTFAAFKWA LIRNNSQVAT 550
    TGTAVCINFC IIMLLNVLYE KVALLLTNLE QPRTESEWEN SFTLKMFLFQ 600
    FVNLNSSTFY IAFFLGRFTG HPGAYLRLIN RWRLEECHPS GCLIDLCMQM 650
    GIIMVLKQTW NNFMELGYPL IQNWWTRRKV RQEHGPERKI SFPQWEKDYN 700
    LQPMNAYGLF DEYLEMILQF GFTTIFVAAF PLAPLLALLN NIIEIRLDAY 750
    KFVTQWRRPL ASRAKDIGIW YGILEGIGIL SVITNAFVIA ITSDFIPRLV 800
    YAYKYGPCAG QGEAGQKCMV GYVNASLSVF RISDFENRSE PESDGSEFSG 850
    TPLKYCRYRD YRDPPHSLVP YGYTLQFWHV LAARLAFIIV FEHLVFCIKH 900
    LISYLIPDLP KDLRDRMRRE KYLIQEMMYE AELERLQKER KERKKNGKAH 950
    HNEWP 955
    Length:955
    Mass (Da):111,462
    Last modified:December 6, 2005 - v1
    Checksum:i9A9348C61A4F20AF
    GO
    Isoform 2 (identifier: Q32M45-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V

    Show »
    Length:920
    Mass (Da):107,612
    Checksum:iBAA2D80DE848F4F9
    GO
    Isoform 3 (identifier: Q32M45-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-433: Missing.
         466-512: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:475
    Mass (Da):55,719
    Checksum:iE6FC96E22BA79519
    GO

    Sequence cautioni

    The sequence BAC03688.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti209 – 2091F → L in BAC03704. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti115 – 1151G → A.
    Corresponds to variant rs34162417 [ dbSNP | Ensembl ].
    VAR_032453

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 433433Missing in isoform 3. 1 PublicationVSP_025741Add
    BLAST
    Alternative sequencei19 – 5436EGGVD…AIQEM → V in isoform 2. 1 PublicationVSP_025742Add
    BLAST
    Alternative sequencei466 – 51247Missing in isoform 3. 1 PublicationVSP_025743Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK091540 mRNA. Translation: BAC03688.1. Different initiation.
    AK091591 mRNA. Translation: BAC03704.1.
    AK092596 mRNA. Translation: BAC03924.1.
    BC109308 mRNA. Translation: AAI09309.1.
    CCDSiCCDS31884.1. [Q32M45-2]
    CCDS66445.1. [Q32M45-1]
    RefSeqiNP_001273544.1. NM_001286615.1. [Q32M45-1]
    NP_001273545.1. NM_001286616.1. [Q32M45-1]
    NP_849148.2. NM_178826.3. [Q32M45-2]
    UniGeneiHs.58785.

    Genome annotation databases

    EnsembliENST00000392977; ENSP00000376703; ENSG00000151572. [Q32M45-1]
    ENST00000392979; ENSP00000376705; ENSG00000151572. [Q32M45-2]
    ENST00000550015; ENSP00000450192; ENSG00000151572. [Q32M45-3]
    ENST00000570509; ENSP00000471431; ENSG00000262139.
    ENST00000573650; ENSP00000469449; ENSG00000262139.
    ENST00000575847; ENSP00000470039; ENSG00000262139.
    ENST00000594618; ENSP00000471210; ENSG00000262139.
    GeneIDi121601.
    KEGGihsa:121601.
    UCSCiuc001thw.2. human. [Q32M45-2]
    uc001thx.2. human. [Q32M45-1]
    uc001thy.2. human. [Q32M45-3]

    Polymorphism databases

    DMDMi121942141.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK091540 mRNA. Translation: BAC03688.1 . Different initiation.
    AK091591 mRNA. Translation: BAC03704.1 .
    AK092596 mRNA. Translation: BAC03924.1 .
    BC109308 mRNA. Translation: AAI09309.1 .
    CCDSi CCDS31884.1. [Q32M45-2 ]
    CCDS66445.1. [Q32M45-1 ]
    RefSeqi NP_001273544.1. NM_001286615.1. [Q32M45-1 ]
    NP_001273545.1. NM_001286616.1. [Q32M45-1 ]
    NP_849148.2. NM_178826.3. [Q32M45-2 ]
    UniGenei Hs.58785.

    3D structure databases

    ProteinModelPortali Q32M45.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000376705.

    PTM databases

    PhosphoSitei Q32M45.

    Polymorphism databases

    DMDMi 121942141.

    Proteomic databases

    PaxDbi Q32M45.
    PRIDEi Q32M45.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000392977 ; ENSP00000376703 ; ENSG00000151572 . [Q32M45-1 ]
    ENST00000392979 ; ENSP00000376705 ; ENSG00000151572 . [Q32M45-2 ]
    ENST00000550015 ; ENSP00000450192 ; ENSG00000151572 . [Q32M45-3 ]
    ENST00000570509 ; ENSP00000471431 ; ENSG00000262139 .
    ENST00000573650 ; ENSP00000469449 ; ENSG00000262139 .
    ENST00000575847 ; ENSP00000470039 ; ENSG00000262139 .
    ENST00000594618 ; ENSP00000471210 ; ENSG00000262139 .
    GeneIDi 121601.
    KEGGi hsa:121601.
    UCSCi uc001thw.2. human. [Q32M45-2 ]
    uc001thx.2. human. [Q32M45-1 ]
    uc001thy.2. human. [Q32M45-3 ]

    Organism-specific databases

    CTDi 121601.
    GeneCardsi GC12P101111.
    HGNCi HGNC:23837. ANO4.
    HPAi HPA053412.
    MIMi 610111. gene.
    neXtProti NX_Q32M45.
    PharmGKBi PA164715582.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG320103.
    HOGENOMi HOG000006509.
    HOVERGENi HBG069519.
    OMAi CFPLHEG.
    PhylomeDBi Q32M45.
    TreeFami TF314265.

    Enzyme and pathway databases

    Reactomei REACT_160189. Stimuli-sensing channels.

    Miscellaneous databases

    ChiTaRSi ANO4. human.
    GenomeRNAii 121601.
    NextBioi 80786.
    PROi Q32M45.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q32M45.
    Bgeei Q32M45.
    CleanExi HS_ANO4.
    Genevestigatori Q32M45.

    Family and domain databases

    InterProi IPR007632. Anoctamin.
    [Graphical view ]
    PANTHERi PTHR12308. PTHR12308. 1 hit.
    Pfami PF04547. Anoctamin. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Prostate.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products."
      Katoh M., Katoh M.
      Int. J. Oncol. 22:1375-1381(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    4. "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
      Duran C., Hartzell H.C.
      Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    5. Cited for: REVIEW.
    6. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
      Winpenny J.P., Gray M.A.
      Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    7. "Anoctamins are a family of Ca2+ activated Cl- channels."
      Tian Y., Schreiber R., Kunzelmann K.
      J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiANO4_HUMAN
    AccessioniPrimary (citable) accession number: Q32M45
    Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: December 6, 2005
    Last modified: October 1, 2014
    This is version 79 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3