Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q32M45

- ANO4_HUMAN

UniProt

Q32M45 - ANO4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Anoctamin-4

Gene

ANO4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide. Does not exhibit calcium-activated chloride channel (CaCC) activity.By similarity

GO - Molecular functioni

  1. intracellular calcium activated chloride channel activity Source: UniProt

GO - Biological processi

  1. chloride transmembrane transport Source: GOC
  2. chloride transport Source: UniProt
  3. ion transmembrane transport Source: Reactome
  4. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Enzyme and pathway databases

ReactomeiREACT_160189. Stimuli-sensing channels.
REACT_267716. Orphan transporters.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-4
Alternative name(s):
Transmembrane protein 16D
Gene namesi
Name:ANO4
Synonyms:TMEM16D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12, UP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:23837. ANO4.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Shows an intracellular localization.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 352352ExtracellularSequence AnalysisAdd
BLAST
Transmembranei353 – 37321HelicalSequence AnalysisAdd
BLAST
Topological domaini374 – 42451CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei425 – 44521HelicalSequence AnalysisAdd
BLAST
Topological domaini446 – 50560ExtracellularSequence AnalysisAdd
BLAST
Transmembranei506 – 52621HelicalSequence AnalysisAdd
BLAST
Topological domaini527 – 54721CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei548 – 56821HelicalSequence AnalysisAdd
BLAST
Topological domaini569 – 59527ExtracellularSequence AnalysisAdd
BLAST
Transmembranei596 – 61621HelicalSequence AnalysisAdd
BLAST
Topological domaini617 – 71599CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei716 – 73621HelicalSequence AnalysisAdd
BLAST
Topological domaini737 – 76832ExtracellularSequence AnalysisAdd
BLAST
Transmembranei769 – 78921HelicalSequence AnalysisAdd
BLAST
Topological domaini790 – 88596CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei886 – 90621HelicalSequence AnalysisAdd
BLAST
Topological domaini907 – 95549ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: UniProtKB
  3. plasma membrane Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164715582.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 955955Anoctamin-4PRO_0000288650Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
Glycosylationi105 – 1051N-linked (GlcNAc...)Sequence Analysis
Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis
Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ32M45.
PRIDEiQ32M45.

PTM databases

PhosphoSiteiQ32M45.

Expressioni

Gene expression databases

BgeeiQ32M45.
CleanExiHS_ANO4.
ExpressionAtlasiQ32M45. baseline and differential.
GenevestigatoriQ32M45.

Organism-specific databases

HPAiHPA053412.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000376705.

Structurei

3D structure databases

ProteinModelPortaliQ32M45.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi462 – 4676Poly-Glu

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG320103.
GeneTreeiENSGT00760000119015.
HOGENOMiHOG000006509.
HOVERGENiHBG069519.
InParanoidiQ32M45.
OMAiCFPLHEG.
PhylomeDBiQ32M45.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q32M45-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEASSSGITN GKTKVFHPEG GVDLQGYQLD MQILPDGPKS DVDFSEILNA
60 70 80 90 100
IQEMAKDVNI LFDELEAVSS PCKDDDSLLH PGNLTSTSDD ASRLEAGGET
110 120 130 140 150
VPERNKSNGL YFRDGKCRID YILVYRKSNP QTEKREVFER NIRAEGLQME
160 170 180 190 200
KESSLINSDI IFVKLHAPWE VLGRYAEQMN VRMPFRRKIY YLPRRYKFMS
210 220 230 240 250
RIDKQISRFR RWLPKKPMRL DKETLPDLEE NDCYTAPFSQ QRIHHFIIHN
260 270 280 290 300
KETFFNNATR SRIVHHILQR IKYEEGKNKI GLNRLLTNGS YEAAFPLHEG
310 320 330 340 350
SYRSKNSIRT HGAENHRHLL YECWASWGVW YKYQPLDLVR RYFGEKIGLY
360 370 380 390 400
FAWLGWYTGM LFPAAFIGLF VFLYGVTTLD HSQVSKEVCQ ATDIIMCPVC
410 420 430 440 450
DKYCPFMRLS DSCVYAKVTH LFDNGATVFF AVFMAVWATV FLEFWKRRRA
460 470 480 490 500
VIAYDWDLID WEEEEEEIRP QFEAKYSKKE RMNPISGKPE PYQAFTDKCS
510 520 530 540 550
RLIVSASGIF FMICVVIAAV FGIVIYRVVT VSTFAAFKWA LIRNNSQVAT
560 570 580 590 600
TGTAVCINFC IIMLLNVLYE KVALLLTNLE QPRTESEWEN SFTLKMFLFQ
610 620 630 640 650
FVNLNSSTFY IAFFLGRFTG HPGAYLRLIN RWRLEECHPS GCLIDLCMQM
660 670 680 690 700
GIIMVLKQTW NNFMELGYPL IQNWWTRRKV RQEHGPERKI SFPQWEKDYN
710 720 730 740 750
LQPMNAYGLF DEYLEMILQF GFTTIFVAAF PLAPLLALLN NIIEIRLDAY
760 770 780 790 800
KFVTQWRRPL ASRAKDIGIW YGILEGIGIL SVITNAFVIA ITSDFIPRLV
810 820 830 840 850
YAYKYGPCAG QGEAGQKCMV GYVNASLSVF RISDFENRSE PESDGSEFSG
860 870 880 890 900
TPLKYCRYRD YRDPPHSLVP YGYTLQFWHV LAARLAFIIV FEHLVFCIKH
910 920 930 940 950
LISYLIPDLP KDLRDRMRRE KYLIQEMMYE AELERLQKER KERKKNGKAH

HNEWP
Length:955
Mass (Da):111,462
Last modified:December 6, 2005 - v1
Checksum:i9A9348C61A4F20AF
GO
Isoform 2 (identifier: Q32M45-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V

Show »
Length:920
Mass (Da):107,612
Checksum:iBAA2D80DE848F4F9
GO
Isoform 3 (identifier: Q32M45-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-433: Missing.
     466-512: Missing.

Note: No experimental confirmation available.

Show »
Length:475
Mass (Da):55,719
Checksum:iE6FC96E22BA79519
GO

Sequence cautioni

The sequence BAC03688.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti209 – 2091F → L in BAC03704. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti115 – 1151G → A.
Corresponds to variant rs34162417 [ dbSNP | Ensembl ].
VAR_032453

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 433433Missing in isoform 3. 1 PublicationVSP_025741Add
BLAST
Alternative sequencei19 – 5436EGGVD…AIQEM → V in isoform 2. 1 PublicationVSP_025742Add
BLAST
Alternative sequencei466 – 51247Missing in isoform 3. 1 PublicationVSP_025743Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091540 mRNA. Translation: BAC03688.1. Different initiation.
AK091591 mRNA. Translation: BAC03704.1.
AK092596 mRNA. Translation: BAC03924.1.
BC109308 mRNA. Translation: AAI09309.1.
CCDSiCCDS31884.1. [Q32M45-2]
CCDS66445.1. [Q32M45-1]
RefSeqiNP_001273544.1. NM_001286615.1. [Q32M45-1]
NP_001273545.1. NM_001286616.1. [Q32M45-1]
NP_849148.2. NM_178826.3. [Q32M45-2]
UniGeneiHs.58785.

Genome annotation databases

EnsembliENST00000392977; ENSP00000376703; ENSG00000151572. [Q32M45-1]
ENST00000392979; ENSP00000376705; ENSG00000151572. [Q32M45-2]
ENST00000550015; ENSP00000450192; ENSG00000151572. [Q32M45-3]
ENST00000570509; ENSP00000471431; ENSG00000262139.
ENST00000573650; ENSP00000469449; ENSG00000262139.
ENST00000575847; ENSP00000470039; ENSG00000262139.
ENST00000594618; ENSP00000471210; ENSG00000262139.
GeneIDi121601.
KEGGihsa:121601.
UCSCiuc001thw.2. human. [Q32M45-2]
uc001thx.2. human. [Q32M45-1]
uc001thy.2. human. [Q32M45-3]

Polymorphism databases

DMDMi121942141.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091540 mRNA. Translation: BAC03688.1 . Different initiation.
AK091591 mRNA. Translation: BAC03704.1 .
AK092596 mRNA. Translation: BAC03924.1 .
BC109308 mRNA. Translation: AAI09309.1 .
CCDSi CCDS31884.1. [Q32M45-2 ]
CCDS66445.1. [Q32M45-1 ]
RefSeqi NP_001273544.1. NM_001286615.1. [Q32M45-1 ]
NP_001273545.1. NM_001286616.1. [Q32M45-1 ]
NP_849148.2. NM_178826.3. [Q32M45-2 ]
UniGenei Hs.58785.

3D structure databases

ProteinModelPortali Q32M45.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000376705.

PTM databases

PhosphoSitei Q32M45.

Polymorphism databases

DMDMi 121942141.

Proteomic databases

PaxDbi Q32M45.
PRIDEi Q32M45.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000392977 ; ENSP00000376703 ; ENSG00000151572 . [Q32M45-1 ]
ENST00000392979 ; ENSP00000376705 ; ENSG00000151572 . [Q32M45-2 ]
ENST00000550015 ; ENSP00000450192 ; ENSG00000151572 . [Q32M45-3 ]
ENST00000570509 ; ENSP00000471431 ; ENSG00000262139 .
ENST00000573650 ; ENSP00000469449 ; ENSG00000262139 .
ENST00000575847 ; ENSP00000470039 ; ENSG00000262139 .
ENST00000594618 ; ENSP00000471210 ; ENSG00000262139 .
GeneIDi 121601.
KEGGi hsa:121601.
UCSCi uc001thw.2. human. [Q32M45-2 ]
uc001thx.2. human. [Q32M45-1 ]
uc001thy.2. human. [Q32M45-3 ]

Organism-specific databases

CTDi 121601.
GeneCardsi GC12P101111.
HGNCi HGNC:23837. ANO4.
HPAi HPA053412.
MIMi 610111. gene.
neXtProti NX_Q32M45.
PharmGKBi PA164715582.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG320103.
GeneTreei ENSGT00760000119015.
HOGENOMi HOG000006509.
HOVERGENi HBG069519.
InParanoidi Q32M45.
OMAi CFPLHEG.
PhylomeDBi Q32M45.
TreeFami TF314265.

Enzyme and pathway databases

Reactomei REACT_160189. Stimuli-sensing channels.
REACT_267716. Orphan transporters.

Miscellaneous databases

ChiTaRSi ANO4. human.
GenomeRNAii 121601.
NextBioi 80786.
PROi Q32M45.
SOURCEi Search...

Gene expression databases

Bgeei Q32M45.
CleanExi HS_ANO4.
ExpressionAtlasi Q32M45. baseline and differential.
Genevestigatori Q32M45.

Family and domain databases

InterProi IPR007632. Anoctamin.
[Graphical view ]
PANTHERi PTHR12308. PTHR12308. 1 hit.
Pfami PF04547. Anoctamin. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Prostate.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products."
    Katoh M., Katoh M.
    Int. J. Oncol. 22:1375-1381(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  4. "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
    Duran C., Hartzell H.C.
    Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  5. Cited for: REVIEW.
  6. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
    Winpenny J.P., Gray M.A.
    Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  7. "Anoctamins are a family of Ca2+ activated Cl- channels."
    Tian Y., Schreiber R., Kunzelmann K.
    J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiANO4_HUMAN
AccessioniPrimary (citable) accession number: Q32M45
Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: December 6, 2005
Last modified: November 26, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3