Reviewed,
UniProtKB/Swiss-Prot Q32M45 (ANO4_HUMAN)
Last modified
December 15, 2009.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Anoctamin-4 Alternative name(s): Transmembrane protein 16D | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 955 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | May act as a calcium-activated chloride channel. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the anoctamin family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| Ligand | Calcium Chloride |
| Molecular function | Chloride channel Ionic channel |
| PTM | Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | ion transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | chloride channel complex Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW chloride channel activityInferred from electronic annotation. Source: UniProtKB-KW chloride ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q32M45-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q32M45-2) The sequence of this isoform differs from the canonical sequence as follows: 19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V | ||||||
| Isoform 3 (identifier: Q32M45-3) The sequence of this isoform differs from the canonical sequence as follows: 1-433: Missing. 466-512: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 955 | 955 | Anoctamin-4 | PRO_0000288650 | |||||
Regions | |||||||||
| Topological domain | 1 – 352 | 352 | Extracellular Potential | ||||||
| Transmembrane | 353 – 373 | 21 | Potential | ||||||
| Topological domain | 374 – 424 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 425 – 445 | 21 | Potential | ||||||
| Topological domain | 446 – 505 | 60 | Extracellular Potential | ||||||
| Transmembrane | 506 – 526 | 21 | Potential | ||||||
| Topological domain | 527 – 547 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 548 – 568 | 21 | Potential | ||||||
| Topological domain | 569 – 595 | 27 | Extracellular Potential | ||||||
| Transmembrane | 596 – 616 | 21 | Potential | ||||||
| Topological domain | 617 – 715 | 99 | Cytoplasmic Potential | ||||||
| Transmembrane | 716 – 736 | 21 | Potential | ||||||
| Topological domain | 737 – 768 | 32 | Extracellular Potential | ||||||
| Transmembrane | 769 – 789 | 21 | Potential | ||||||
| Topological domain | 790 – 885 | 96 | Cytoplasmic Potential | ||||||
| Transmembrane | 886 – 906 | 21 | Potential | ||||||
| Topological domain | 907 – 955 | 49 | Extracellular Potential | ||||||
| Compositional bias | 462 – 467 | 6 | Poly-Glu | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 105 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 257 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 433 | 433 | Missing in isoform 3. | VSP_025741 | |||||
| Alternative sequence | 19 – 54 | 36 | EGGVD…AIQEM → V in isoform 2. | VSP_025742 | |||||
| Alternative sequence | 466 – 512 | 47 | Missing in isoform 3. | VSP_025743 | |||||
| Natural variant | 115 | 1 | G → A: dbSNP rs34162417. | VAR_032453 | |||||
Experimental info | |||||||||
| Sequence conflict | 209 | 1 | F → L in BAC03704. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Prostate. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products." Katoh M., Katoh M. Int. J. Oncol. 22:1375-1381(2003) [PubMed: 12739008] [Abstract] Cited for: IDENTIFICATION. |
| [4] | "TMEM16A confers receptor-activated calcium-dependent chloride conductance." Yang Y.D., Cho H., Koo J.Y., Tak M.H., Cho Y., Shim W.-S., Park S.P., Lee J., Lee B., Kim B.-M., Raouf R., Shin Y.K., Oh U. Nature 455:1210-1215(2008) [PubMed: 18724360] [Abstract] Cited for: IDENTIFICATION AS PUTATIVE CHLORIDE CHANNEL. |
Cross-references
Sequence databases | |
|---|---|
| AK091540 mRNA. Translation: BAC03688.1. Different initiation. AK091591 mRNA. Translation: BAC03704.1. AK092596 mRNA. Translation: BAC03924.1. BC109308 mRNA. Translation: AAI09309.1. | |
| IPI | IPI00177878. IPI00249140. IPI00847500. |
| RefSeq | NP_849148.2. |
| UniGene | Hs.58785 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q32M45. |
PTM databases | |
| PhosphoSite | Q32M45. |
Genome annotation databases | |
| Ensembl | ENST00000392977; ENSP00000376703; ENSG00000151572; Homo sapiens. [Genome view] |
| GeneID | 121601. |
| KEGG | hsa:121601. |
| UCSC | uc001thw.1. human. uc001thx.1. human. uc001thy.1. human. |
Organism-specific databases | |
| CTD | 121601. |
| GeneCards | GC12P099712. |
| HGNC | HGNC:23837. ANO4. |
| MIM | 610111. gene. |
| PharmGKB | PA134975112. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG357842. |
| HOVERGEN | Q32M45. |
| OMA | NAIQEMA. |
| OrthoDB | EOG99PDHX. |
Gene expression databases | |
| ArrayExpress | Q32M45. |
| Bgee | Q32M45. |
| CleanEx | HS_ANO4. |
| Genevestigator | Q32M45. |
Family and domain databases | |
| InterPro | IPR007632. DUF590. [Graphical view] |
| PANTHER | PTHR12308. DUF590. 1 hit. |
| Pfam | PF04547. DUF590. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 80786. |
| SOURCE | Search... |
Entry information
| Entry name | ANO4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q32M45 Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


