Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q32M45 (ANO4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Anoctamin-4
Alternative name(s):
Transmembrane protein 16D
Gene names
Name:ANO4
Synonyms:TMEM16D
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length955 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Does not exhibit calcium-activated chloride channel (CaCC) activity By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein. Note: Shows an intracellular localization By similarity. Ref.7

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Sequence similarities

Belongs to the anoctamin family.

Sequence caution

The sequence BAC03688.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q32M45-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q32M45-2)

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V
Isoform 3 (identifier: Q32M45-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-433: Missing.
     466-512: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 955955Anoctamin-4
PRO_0000288650

Regions

Topological domain1 – 352352Extracellular Potential
Transmembrane353 – 37321Helical; Potential
Topological domain374 – 42451Cytoplasmic Potential
Transmembrane425 – 44521Helical; Potential
Topological domain446 – 50560Extracellular Potential
Transmembrane506 – 52621Helical; Potential
Topological domain527 – 54721Cytoplasmic Potential
Transmembrane548 – 56821Helical; Potential
Topological domain569 – 59527Extracellular Potential
Transmembrane596 – 61621Helical; Potential
Topological domain617 – 71599Cytoplasmic Potential
Transmembrane716 – 73621Helical; Potential
Topological domain737 – 76832Extracellular Potential
Transmembrane769 – 78921Helical; Potential
Topological domain790 – 88596Cytoplasmic Potential
Transmembrane886 – 90621Helical; Potential
Topological domain907 – 95549Extracellular Potential
Compositional bias462 – 4676Poly-Glu

Amino acid modifications

Glycosylation831N-linked (GlcNAc...) Potential
Glycosylation1051N-linked (GlcNAc...) Potential
Glycosylation2571N-linked (GlcNAc...) Potential
Glycosylation2881N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 433433Missing in isoform 3.
VSP_025741
Alternative sequence19 – 5436EGGVD…AIQEM → V in isoform 2.
VSP_025742
Alternative sequence466 – 51247Missing in isoform 3.
VSP_025743
Natural variant1151G → A.
Corresponds to variant rs34162417 [ dbSNP | Ensembl ].
VAR_032453

Experimental info

Sequence conflict2091F → L in BAC03704. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 6, 2005. Version 1.
Checksum: 9A9348C61A4F20AF

FASTA955111,462
        10         20         30         40         50         60 
MEASSSGITN GKTKVFHPEG GVDLQGYQLD MQILPDGPKS DVDFSEILNA IQEMAKDVNI 

        70         80         90        100        110        120 
LFDELEAVSS PCKDDDSLLH PGNLTSTSDD ASRLEAGGET VPERNKSNGL YFRDGKCRID 

       130        140        150        160        170        180 
YILVYRKSNP QTEKREVFER NIRAEGLQME KESSLINSDI IFVKLHAPWE VLGRYAEQMN 

       190        200        210        220        230        240 
VRMPFRRKIY YLPRRYKFMS RIDKQISRFR RWLPKKPMRL DKETLPDLEE NDCYTAPFSQ 

       250        260        270        280        290        300 
QRIHHFIIHN KETFFNNATR SRIVHHILQR IKYEEGKNKI GLNRLLTNGS YEAAFPLHEG 

       310        320        330        340        350        360 
SYRSKNSIRT HGAENHRHLL YECWASWGVW YKYQPLDLVR RYFGEKIGLY FAWLGWYTGM 

       370        380        390        400        410        420 
LFPAAFIGLF VFLYGVTTLD HSQVSKEVCQ ATDIIMCPVC DKYCPFMRLS DSCVYAKVTH 

       430        440        450        460        470        480 
LFDNGATVFF AVFMAVWATV FLEFWKRRRA VIAYDWDLID WEEEEEEIRP QFEAKYSKKE 

       490        500        510        520        530        540 
RMNPISGKPE PYQAFTDKCS RLIVSASGIF FMICVVIAAV FGIVIYRVVT VSTFAAFKWA 

       550        560        570        580        590        600 
LIRNNSQVAT TGTAVCINFC IIMLLNVLYE KVALLLTNLE QPRTESEWEN SFTLKMFLFQ 

       610        620        630        640        650        660 
FVNLNSSTFY IAFFLGRFTG HPGAYLRLIN RWRLEECHPS GCLIDLCMQM GIIMVLKQTW 

       670        680        690        700        710        720 
NNFMELGYPL IQNWWTRRKV RQEHGPERKI SFPQWEKDYN LQPMNAYGLF DEYLEMILQF 

       730        740        750        760        770        780 
GFTTIFVAAF PLAPLLALLN NIIEIRLDAY KFVTQWRRPL ASRAKDIGIW YGILEGIGIL 

       790        800        810        820        830        840 
SVITNAFVIA ITSDFIPRLV YAYKYGPCAG QGEAGQKCMV GYVNASLSVF RISDFENRSE 

       850        860        870        880        890        900 
PESDGSEFSG TPLKYCRYRD YRDPPHSLVP YGYTLQFWHV LAARLAFIIV FEHLVFCIKH 

       910        920        930        940        950 
LISYLIPDLP KDLRDRMRRE KYLIQEMMYE AELERLQKER KERKKNGKAH HNEWP 

« Hide

Isoform 2 [UniParc].

Checksum: BAA2D80DE848F4F9
Show »

FASTA920107,612
Isoform 3 [UniParc].

Checksum: E6FC96E22BA79519
Show »

FASTA47555,719

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Prostate.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products."
Katoh M., Katoh M.
Int. J. Oncol. 22:1375-1381(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[4]"Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?"
Duran C., Hartzell H.C.
Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[5]"Anoctamins."
Kunzelmann K., Tian Y., Martins J.R., Faria D., Kongsuphol P., Ousingsawat J., Thevenod F., Roussa E., Rock J., Schreiber R.
Pflugers Arch. 462:195-208(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[6]"The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
Winpenny J.P., Gray M.A.
Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[7]"Anoctamins are a family of Ca2+ activated Cl- channels."
Tian Y., Schreiber R., Kunzelmann K.
J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK091540 mRNA. Translation: BAC03688.1. Different initiation.
AK091591 mRNA. Translation: BAC03704.1.
AK092596 mRNA. Translation: BAC03924.1.
BC109308 mRNA. Translation: AAI09309.1.
RefSeqNP_001273544.1. NM_001286615.1.
NP_001273545.1. NM_001286616.1.
NP_849148.2. NM_178826.3.
UniGeneHs.58785.

3D structure databases

ProteinModelPortalQ32M45.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000376705.

PTM databases

PhosphoSiteQ32M45.

Polymorphism databases

DMDM121942141.

Proteomic databases

PaxDbQ32M45.
PRIDEQ32M45.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000299222; ENSP00000299222; ENSG00000151572. [Q32M45-3]
ENST00000392977; ENSP00000376703; ENSG00000151572. [Q32M45-1]
ENST00000392979; ENSP00000376705; ENSG00000151572. [Q32M45-2]
ENST00000550015; ENSP00000450192; ENSG00000151572. [Q32M45-3]
ENST00000570509; ENSP00000471431; ENSG00000262139.
ENST00000573650; ENSP00000469449; ENSG00000262139.
ENST00000575847; ENSP00000470039; ENSG00000262139.
ENST00000594618; ENSP00000471210; ENSG00000262139.
GeneID121601.
KEGGhsa:121601.
UCSCuc001thw.2. human. [Q32M45-2]
uc001thx.2. human. [Q32M45-1]
uc001thy.2. human. [Q32M45-3]

Organism-specific databases

CTD121601.
GeneCardsGC12P101111.
HGNCHGNC:23837. ANO4.
HPAHPA053412.
MIM610111. gene.
neXtProtNX_Q32M45.
PharmGKBPA164715582.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG320103.
HOGENOMHOG000006509.
HOVERGENHBG069519.
OMACFPLHEG.
PhylomeDBQ32M45.
TreeFamTF314265.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ32M45.
BgeeQ32M45.
CleanExHS_ANO4.
GenevestigatorQ32M45.

Family and domain databases

InterProIPR007632. Anoctamin.
[Graphical view]
PANTHERPTHR12308. PTHR12308. 1 hit.
PfamPF04547. Anoctamin. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSANO4. human.
GenomeRNAi121601.
NextBio80786.
PROQ32M45.
SOURCESearch...

Entry information

Entry nameANO4_HUMAN
AccessionPrimary (citable) accession number: Q32M45
Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: December 6, 2005
Last modified: April 16, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM