Q32M45 (ANO4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Anoctamin-4 Alternative name(s): Transmembrane protein 16D | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 955 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Does not exhibit calcium-activated chloride channel (CaCC) activity By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Note: Shows an intracellular localization By similarity. Ref.7 |
| Miscellaneous | The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology. |
| Sequence similarities | Belongs to the anoctamin family. |
| Sequence caution | The sequence BAC03688.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW intracellularInferred from sequence or structural similarity. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q32M45-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q32M45-2) The sequence of this isoform differs from the canonical sequence as follows: 19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V | ||||||
| Isoform 3 (identifier: Q32M45-3) The sequence of this isoform differs from the canonical sequence as follows: 1-433: Missing. 466-512: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 955 | 955 | Anoctamin-4 | PRO_0000288650 | |||||
Regions | |||||||||
| Topological domain | 1 – 352 | 352 | Extracellular Potential | ||||||
| Transmembrane | 353 – 373 | 21 | Helical; Potential | ||||||
| Topological domain | 374 – 424 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 425 – 445 | 21 | Helical; Potential | ||||||
| Topological domain | 446 – 505 | 60 | Extracellular Potential | ||||||
| Transmembrane | 506 – 526 | 21 | Helical; Potential | ||||||
| Topological domain | 527 – 547 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 548 – 568 | 21 | Helical; Potential | ||||||
| Topological domain | 569 – 595 | 27 | Extracellular Potential | ||||||
| Transmembrane | 596 – 616 | 21 | Helical; Potential | ||||||
| Topological domain | 617 – 715 | 99 | Cytoplasmic Potential | ||||||
| Transmembrane | 716 – 736 | 21 | Helical; Potential | ||||||
| Topological domain | 737 – 768 | 32 | Extracellular Potential | ||||||
| Transmembrane | 769 – 789 | 21 | Helical; Potential | ||||||
| Topological domain | 790 – 885 | 96 | Cytoplasmic Potential | ||||||
| Transmembrane | 886 – 906 | 21 | Helical; Potential | ||||||
| Topological domain | 907 – 955 | 49 | Extracellular Potential | ||||||
| Compositional bias | 462 – 467 | 6 | Poly-Glu | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 105 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 257 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 433 | 433 | Missing in isoform 3. | VSP_025741 | |||||
| Alternative sequence | 19 – 54 | 36 | EGGVD…AIQEM → V in isoform 2. | VSP_025742 | |||||
| Alternative sequence | 466 – 512 | 47 | Missing in isoform 3. | VSP_025743 | |||||
| Natural variant | 115 | 1 | G → A. Corresponds to variant rs34162417 [ dbSNP | Ensembl ]. | VAR_032453 | |||||
Experimental info | |||||||||
| Sequence conflict | 209 | 1 | F → L in BAC03704. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Prostate. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products." Katoh M., Katoh M. Int. J. Oncol. 22:1375-1381(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [4] | "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?" Duran C., Hartzell H.C. Acta Pharmacol. Sin. 32:685-692(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [5] | "Anoctamins." Kunzelmann K., Tian Y., Martins J.R., Faria D., Kongsuphol P., Ousingsawat J., Thevenod F., Roussa E., Rock J., Schreiber R. Pflugers Arch. 462:195-208(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [6] | "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age." Winpenny J.P., Gray M.A. Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [7] | "Anoctamins are a family of Ca2+ activated Cl- channels." Tian Y., Schreiber R., Kunzelmann K. J. Cell Sci. 125:4991-4998(2012) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK091540 mRNA. Translation: BAC03688.1. Different initiation. AK091591 mRNA. Translation: BAC03704.1. AK092596 mRNA. Translation: BAC03924.1. BC109308 mRNA. Translation: AAI09309.1. |
| IPI | IPI00177878. IPI00249140. IPI00847500. |
| RefSeq | NP_849148.2. NM_178826.3. |
| UniGene | Hs.58785. |
3D structure databases | |
| ProteinModelPortal | Q32M45. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000376705. |
PTM databases | |
| PhosphoSite | Q32M45. |
Polymorphism databases | |
| DMDM | 121942141. |
Proteomic databases | |
| PaxDb | Q32M45. |
| PRIDE | Q32M45. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000299222; ENSP00000299222; ENSG00000151572. ENST00000392977; ENSP00000376703; ENSG00000151572. ENST00000392979; ENSP00000376705; ENSG00000151572. ENST00000550015; ENSP00000450192; ENSG00000151572. ENST00000570509; ENSP00000471431; ENSG00000262139. ENST00000573650; ENSP00000469449; ENSG00000262139. ENST00000575847; ENSP00000470039; ENSG00000262139. ENST00000594618; ENSP00000471210; ENSG00000262139. |
| GeneID | 121601. |
| KEGG | hsa:121601. |
| UCSC | uc001thw.2. human. uc001thx.2. human. uc001thy.2. human. |
Organism-specific databases | |
| CTD | 121601. |
| GeneCards | GC12P101111. |
| HGNC | HGNC:23837. ANO4. |
| HPA | HPA053412. |
| MIM | 610111. gene. |
| neXtProt | NX_Q32M45. |
| PharmGKB | PA164715582. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG320103. |
| HOGENOM | HOG000006509. |
| HOVERGEN | HBG069519. |
| OMA | TEYEDSY. |
Gene expression databases | |
| ArrayExpress | Q32M45. |
| Bgee | Q32M45. |
| CleanEx | HS_ANO4. |
| Genevestigator | Q32M45. |
Family and domain databases | |
| InterPro | IPR007632. Anoctamin. [Graphical view] |
| PANTHER | PTHR12308. PTHR12308. 1 hit. |
| Pfam | PF04547. Anoctamin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ANO4. human. |
| GenomeRNAi | 121601. |
| NextBio | 80786. |
| SOURCE | Search... |
Entry information
| Entry name | ANO4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q32M45 Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
