SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q2Y0W8

- S4A8_HUMAN

UniProt

Q2Y0W8 - S4A8_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Electroneutral sodium bicarbonate exchanger 1

Gene
SLC4A8, KIAA0739, NBC, NBC3, NDCBE1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3- exchange with a Na+:HCO3- stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3- from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3- into the cells. Also mediates lithium-dependent HCO3- cotransport. May be regulated by osmolarity.By similarity2 Publications

Enzyme regulationi

Activity is inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

GO - Molecular functioni

  1. inorganic anion exchanger activity Source: InterPro

GO - Biological processi

  1. bicarbonate transport Source: Reactome
  2. ion transport Source: Reactome
  3. sodium ion transport Source: UniProtKB-KW
  4. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Anion exchange, Antiport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_19298. Bicarbonate transporters.

Protein family/group databases

TCDBi2.A.31.2.4. the anion exchanger (ae) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Electroneutral sodium bicarbonate exchanger 1
Alternative name(s):
Electroneutral Na(+)-driven Cl-HCO3 exchanger
Solute carrier family 4 member 8
k-NBC3
Gene namesi
Name:SLC4A8
Synonyms:KIAA0739, NBC, NBC3, NDCBE1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:11034. SLC4A8.

Subcellular locationi

Membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 478478Extracellular Reviewed predictionAdd
BLAST
Transmembranei479 – 49921Helical; Reviewed predictionAdd
BLAST
Topological domaini500 – 52324Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei524 – 54421Helical; Reviewed predictionAdd
BLAST
Topological domaini545 – 56521Extracellular Reviewed predictionAdd
BLAST
Transmembranei566 – 58621Helical; Reviewed predictionAdd
BLAST
Topological domaini587 – 5959Cytoplasmic Reviewed prediction
Transmembranei596 – 61621Helical; Reviewed predictionAdd
BLAST
Topological domaini617 – 68771Extracellular Reviewed predictionAdd
BLAST
Transmembranei688 – 70821Helical; Reviewed predictionAdd
BLAST
Topological domaini709 – 73123Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei732 – 75221Helical; Reviewed predictionAdd
BLAST
Topological domaini753 – 77826Extracellular Reviewed predictionAdd
BLAST
Transmembranei779 – 79921Helical; Reviewed predictionAdd
BLAST
Topological domaini800 – 82425Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei825 – 84521Helical; Reviewed predictionAdd
BLAST
Topological domaini846 – 88136Extracellular Reviewed predictionAdd
BLAST
Transmembranei882 – 90221Helical; Reviewed predictionAdd
BLAST
Topological domaini903 – 9042Cytoplasmic Reviewed prediction
Transmembranei905 – 92521Helical; Reviewed predictionAdd
BLAST
Topological domaini926 – 96237Extracellular Reviewed predictionAdd
BLAST
Transmembranei963 – 98321Helical; Reviewed predictionAdd
BLAST
Topological domaini984 – 1093110Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: InterPro
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35900.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10931093Electroneutral sodium bicarbonate exchanger 1PRO_0000328922Add
BLAST

Proteomic databases

MaxQBiQ2Y0W8.
PaxDbiQ2Y0W8.
PRIDEiQ2Y0W8.

PTM databases

PhosphoSiteiQ2Y0W8.

Expressioni

Tissue specificityi

Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed in pancreas and kidney cortex.3 Publications

Gene expression databases

ArrayExpressiQ2Y0W8.
BgeeiQ2Y0W8.
CleanExiHS_SLC4A8.
GenevestigatoriQ2Y0W8.

Organism-specific databases

HPAiHPA046665.

Interactioni

Protein-protein interaction databases

BioGridi114877. 4 interactions.
IntActiQ2Y0W8. 1 interaction.
STRINGi9606.ENSP00000405812.

Structurei

3D structure databases

ProteinModelPortaliQ2Y0W8.
SMRiQ2Y0W8. Positions 115-398, 462-502.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1010 – 103627 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG268067.
HOGENOMiHOG000280684.
HOVERGENiHBG004326.
KOiK13859.
OMAiVLNIHYE.
OrthoDBiEOG7TMZR0.
PhylomeDBiQ2Y0W8.
TreeFamiTF313630.

Family and domain databases

Gene3Di3.40.1100.10. 1 hit.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 1 hit.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMiSSF55804. SSF55804. 1 hit.
TIGRFAMsiTIGR00834. ae. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q2Y0W8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPAAGSNEPD GVLSYQRPDE EAVVDQGGTS TILNIHYEKE ELEGHRTLYV     50
GVRMPLGRQS HRHHRTHGQK HRRRGRGKGA SQGEEGLEAL AHDTPSQRVQ 100
FILGTEEDEE HVPHELFTEL DEICMKEGED AEWKETARWL KFEEDVEDGG 150
ERWSKPYVAT LSLHSLFELR SCLINGTVLL DMHANSIEEI SDLILDQQEL 200
SSDLNDSMRV KVREALLKKH HHQNEKKRNN LIPIVRSFAE VGKKQSDPHL 250
MDKHGQTVSP QSVPTTNLEV KNGVNCEHSP VDLSKVDLHF MKKIPTGAEA 300
SNVLVGEVDI LDRPIVAFVR LSPAVLLSGL TEVPIPTRFL FILLGPVGKG 350
QQYHEIGRSM ATIMTDEIFH DVAYKAKERD DLLAGIDEFL DQVTVLPPGE 400
WDPSIRIEPP KNVPSQEKRK MPGVPNGNVC HIEQEPHGGH SGPELQRTGR 450
LFGGLVLDIK RKAPWYWSDY RDALSLQCLA SFLFLYCACM SPVITFGGLL 500
GEATEGRISA IESLFGASMT GIAYSLFAGQ ALTILGSTGP VLVFEKILFK 550
FCKDYALSYL SLRACIGLWT AFLCIVLVAT DASSLVCYIT RFTEEAFASL 600
ICIIFIYEAI EKLIHLAETY PIHMHSQLDH LSLYYCRCTL PENPNNHTLQ 650
YWKDHNIVTA EVHWANLTVS ECQEMHGEFM GSACGHHGPY TPDVLFWSCI 700
LFFTTFILSS TLKTFKTSRY FPTRVRSMVS DFAVFLTIFT MVIIDFLIGV 750
PSPKLQVPSV FKPTRDDRGW IINPIGPNPW WTVIAAIIPA LLCTILIFMD 800
QQITAVIINR KEHKLKKGCG YHLDLLMVAI MLGVCSIMGL PWFVAATVLS 850
ITHVNSLKLE SECSAPGEQP KFLGIREQRV TGLMIFVLMG CSVFMTAILK 900
FIPMPVLYGV FLYMGVSSLQ GIQFFDRLKL FGMPAKHQPD FIYLRHVPLR 950
KVHLFTLIQL TCLVLLWVIK ASPAAIVFPM MVLALVFVRK VMDLCFSKRE 1000
LSWLDDLMPE SKKKKLDDAK KKAKEEEEAE KMLEIGGDKF PLESRKLLSS 1050
PGKNISCRCD PSEINISDEM PKTTVWKALS MNSGNAKEKS LFN 1093
Length:1,093
Mass (Da):122,938
Last modified:December 20, 2005 - v1
Checksum:iDDF9D0BC3CBD1A06
GO
Isoform 21 Publication (identifier: Q2Y0W8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MPAAGSNEPDGVLSYQ → MFNKNNSNKLRSTPRYRRGDPGYLNFTELGPLKPEQKDQWSQH
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: No experimental confirmation available.

Show »
Length:1,071
Mass (Da):120,987
Checksum:i6CF28C557074A1EE
GO
Isoform 31 Publication (identifier: Q2Y0W8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: May be due to an intron retention.

Show »
Length:1,044
Mass (Da):117,473
Checksum:i083CF203D4D7FB55
GO
Isoform 41 Publication (identifier: Q2Y0W8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: May be due to an intron retention.

Show »
Length:991
Mass (Da):111,661
Checksum:i41DFC25D0B88F845
GO
Isoform 51 Publication (identifier: Q2Y0W8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.

Show »
Length:1,040
Mass (Da):117,126
Checksum:iA9CB5DD413DCDED7
GO
Isoform 62 Publications (identifier: Q2Y0W8-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
     692-1093: Missing.

Show »
Length:691
Mass (Da):77,094
Checksum:iEACAA9A36A17394B
GO
Isoform 71 Publication (identifier: Q2Y0W8-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     725-800: VRSMVSDFAV...LLCTILIFMD → MESCSVAWLE...RPPKMLGLQA
     801-1093: Missing.

Note: No experimental confirmation available.

Show »
Length:747
Mass (Da):83,968
Checksum:iB02294FA3EB6A40E
GO
Isoform 8 (identifier: Q2Y0W8-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
     692-1093: Missing.

Note: No experimental confirmation available.

Show »
Length:638
Mass (Da):71,283
Checksum:iB8605D6EB82E7098
GO

Sequence cautioni

The sequence BAA34459.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAD38576.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti312 – 3121D → A.
Corresponds to variant rs35966334 [ dbSNP | Ensembl ].
VAR_048351
Natural varianti898 – 8981I → V.
Corresponds to variant rs12318785 [ dbSNP | Ensembl ].
VAR_048352

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5353Missing in isoform 4, isoform 5, isoform 7 and isoform 8. VSP_052759Add
BLAST
Alternative sequencei1 – 1616MPAAG…VLSYQ → MFNKNNSNKLRSTPRYRRGD PGYLNFTELGPLKPEQKDQW SQH in isoform 2. 1 PublicationVSP_052760Add
BLAST
Alternative sequencei671 – 69121ECQEM…HGPYT → VSLGAARCPSIVTTGLGGTS K in isoform 6 and isoform 8. 2 PublicationsVSP_052761Add
BLAST
Alternative sequencei692 – 1093402Missing in isoform 6 and isoform 8. VSP_052762Add
BLAST
Alternative sequencei725 – 80076VRSMV…LIFMD → MESCSVAWLECGGVILAHCN LRLLPSSWDYRHAPPQPANF CIFSRDGVSPCWPGWSQSLD LVICLPRPPKMLGLQA in isoform 7. 1 PublicationVSP_052763Add
BLAST
Alternative sequencei801 – 1093293Missing in isoform 7. 1 PublicationVSP_052764Add
BLAST
Alternative sequencei1028 – 109366EAEKM…KSLFN → VIVLAPTVYLGASNYRT in isoform 2, isoform 3 and isoform 4. 3 PublicationsVSP_052765Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti482 – 4821F → L in BAG58292. 1 Publication
Sequence conflicti1008 – 10081M → T in AAC82380. 1 Publication
Isoform 71 Publication (identifier: Q2Y0W8-7)
Sequence conflicti707 – 7071Q → R in CAD38576. 1 Publication
Sequence conflicti716 – 7161R → G in CAD38576. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF069512 mRNA. Translation: AAC82380.1.
DQ063579 mRNA. Translation: AAY79176.1.
DQ975204 mRNA. Translation: ABJ09587.1.
DQ996537 mRNA. Translation: ABJ91576.1.
DQ996398 mRNA. Translation: ABJ91577.1.
AB018282 mRNA. Translation: BAA34459.1. Different initiation.
AK295315 mRNA. Translation: BAG58292.1.
AL831915 mRNA. Translation: CAD38576.2. Different initiation.
AC025097 Genomic DNA. No translation available.
AC046135 Genomic DNA. No translation available.
AC107031 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58192.1.
BC025994 mRNA. Translation: AAH25994.1.
AF107099 mRNA. Translation: AAD52981.1.
CCDSiCCDS44890.1. [Q2Y0W8-1]
CCDS58232.1. [Q2Y0W8-7]
RefSeqiNP_001035049.1. NM_001039960.2. [Q2Y0W8-1]
NP_001245330.1. NM_001258401.2. [Q2Y0W8-5]
NP_001245331.1. NM_001258402.1. [Q2Y0W8-6]
NP_001245332.1. NM_001258403.1. [Q2Y0W8-7]
NP_001254544.1. NM_001267615.1.
UniGeneiHs.4749.

Genome annotation databases

EnsembliENST00000358657; ENSP00000351483; ENSG00000050438. [Q2Y0W8-2]
ENST00000394856; ENSP00000378325; ENSG00000050438.
ENST00000453097; ENSP00000405812; ENSG00000050438. [Q2Y0W8-1]
ENST00000514353; ENSP00000442561; ENSG00000050438.
ENST00000535225; ENSP00000441520; ENSG00000050438.
GeneIDi9498.
KEGGihsa:9498.
UCSCiuc001rym.4. human. [Q2Y0W8-4]
uc001ryq.4. human. [Q2Y0W8-6]
uc001ryr.3. human. [Q2Y0W8-3]
uc001rys.2. human. [Q2Y0W8-1]
uc010snj.2. human. [Q2Y0W8-2]

Polymorphism databases

DMDMi121942008.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF069512 mRNA. Translation: AAC82380.1 .
DQ063579 mRNA. Translation: AAY79176.1 .
DQ975204 mRNA. Translation: ABJ09587.1 .
DQ996537 mRNA. Translation: ABJ91576.1 .
DQ996398 mRNA. Translation: ABJ91577.1 .
AB018282 mRNA. Translation: BAA34459.1 . Different initiation.
AK295315 mRNA. Translation: BAG58292.1 .
AL831915 mRNA. Translation: CAD38576.2 . Different initiation.
AC025097 Genomic DNA. No translation available.
AC046135 Genomic DNA. No translation available.
AC107031 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58192.1 .
BC025994 mRNA. Translation: AAH25994.1 .
AF107099 mRNA. Translation: AAD52981.1 .
CCDSi CCDS44890.1. [Q2Y0W8-1 ]
CCDS58232.1. [Q2Y0W8-7 ]
RefSeqi NP_001035049.1. NM_001039960.2. [Q2Y0W8-1 ]
NP_001245330.1. NM_001258401.2. [Q2Y0W8-5 ]
NP_001245331.1. NM_001258402.1. [Q2Y0W8-6 ]
NP_001245332.1. NM_001258403.1. [Q2Y0W8-7 ]
NP_001254544.1. NM_001267615.1.
UniGenei Hs.4749.

3D structure databases

ProteinModelPortali Q2Y0W8.
SMRi Q2Y0W8. Positions 115-398, 462-502.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114877. 4 interactions.
IntActi Q2Y0W8. 1 interaction.
STRINGi 9606.ENSP00000405812.

Protein family/group databases

TCDBi 2.A.31.2.4. the anion exchanger (ae) family.

PTM databases

PhosphoSitei Q2Y0W8.

Polymorphism databases

DMDMi 121942008.

Proteomic databases

MaxQBi Q2Y0W8.
PaxDbi Q2Y0W8.
PRIDEi Q2Y0W8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358657 ; ENSP00000351483 ; ENSG00000050438 . [Q2Y0W8-2 ]
ENST00000394856 ; ENSP00000378325 ; ENSG00000050438 .
ENST00000453097 ; ENSP00000405812 ; ENSG00000050438 . [Q2Y0W8-1 ]
ENST00000514353 ; ENSP00000442561 ; ENSG00000050438 .
ENST00000535225 ; ENSP00000441520 ; ENSG00000050438 .
GeneIDi 9498.
KEGGi hsa:9498.
UCSCi uc001rym.4. human. [Q2Y0W8-4 ]
uc001ryq.4. human. [Q2Y0W8-6 ]
uc001ryr.3. human. [Q2Y0W8-3 ]
uc001rys.2. human. [Q2Y0W8-1 ]
uc010snj.2. human. [Q2Y0W8-2 ]

Organism-specific databases

CTDi 9498.
GeneCardsi GC12P051807.
HGNCi HGNC:11034. SLC4A8.
HPAi HPA046665.
MIMi 605024. gene.
neXtProti NX_Q2Y0W8.
PharmGKBi PA35900.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG268067.
HOGENOMi HOG000280684.
HOVERGENi HBG004326.
KOi K13859.
OMAi VLNIHYE.
OrthoDBi EOG7TMZR0.
PhylomeDBi Q2Y0W8.
TreeFami TF313630.

Enzyme and pathway databases

Reactomei REACT_19298. Bicarbonate transporters.

Miscellaneous databases

ChiTaRSi SLC4A8. human.
GeneWikii SLC4A8.
GenomeRNAii 9498.
NextBioi 35584.
PROi Q2Y0W8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q2Y0W8.
Bgeei Q2Y0W8.
CleanExi HS_SLC4A8.
Genevestigatori Q2Y0W8.

Family and domain databases

Gene3Di 3.40.1100.10. 1 hit.
InterProi IPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view ]
PANTHERi PTHR11453. PTHR11453. 1 hit.
Pfami PF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view ]
PRINTSi PR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMi SSF55804. SSF55804. 1 hit.
TIGRFAMsi TIGR00834. ae. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, characterization, and chromosomal mapping of a human electroneutral Na(+)-driven Cl-HCO3 exchanger."
    Grichtchenko I.I., Choi I., Zhong X., Bray-Ward P., Russell J.M., Boron W.F.
    J. Biol. Chem. 276:8358-8363(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
    Tissue: Frontal cortex.
  2. "An electroneutral Na+-driven Cl-HCO3 exchanger (NDCBE1) with a novel COOH-terminus cloned from human brain."
    Bouyer P., Parker M.D., Boron W.F.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5).
    Tissue: Brain and Heart.
  3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
    Tissue: Caudate nucleus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Amygdala.
  6. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Testis.
  9. "Characterization of Na+/HCO-3 cotransporter isoform NBC-3."
    Amlal H., Burnham C.E., Soleimani M.
    Am. J. Physiol. 276:F903-F913(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-670 (ISOFORMS 1/3/6), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
    Tissue: Testis carcinoma.
  10. Erratum
    Amlal H., Burnham C.E., Soleimani M.
    Am. J. Physiol. 277:F477-F477(1999)
  11. "Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues."
    Damkier H.H., Nielsen S., Praetorius J.
    Am. J. Physiol. 293:R2136-R2146(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiS4A8_HUMAN
AccessioniPrimary (citable) accession number: Q2Y0W8
Secondary accession number(s): A0MMZ1
, B4DHY0, E7EML0, F5GZ31, F5H7F5, O94843, O95233, Q004B4, Q8N3U2, Q8TC60, Q9UKX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: December 20, 2005
Last modified: September 3, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi