Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q2Y0W8

- S4A8_HUMAN

UniProt

Q2Y0W8 - S4A8_HUMAN

Protein

Electroneutral sodium bicarbonate exchanger 1

Gene

SLC4A8

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (20 Dec 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3- exchange with a Na+:HCO3- stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3- from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3- into the cells. Also mediates lithium-dependent HCO3- cotransport. May be regulated by osmolarity.2 Publications

    Enzyme regulationi

    Activity is inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

    GO - Molecular functioni

    1. inorganic anion exchanger activity Source: InterPro

    GO - Biological processi

    1. bicarbonate transport Source: Reactome
    2. ion transport Source: Reactome
    3. sodium ion transport Source: UniProtKB-KW
    4. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Anion exchange, Antiport, Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_19298. Bicarbonate transporters.

    Protein family/group databases

    TCDBi2.A.31.2.4. the anion exchanger (ae) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Electroneutral sodium bicarbonate exchanger 1
    Alternative name(s):
    Electroneutral Na(+)-driven Cl-HCO3 exchanger
    Solute carrier family 4 member 8
    k-NBC3
    Gene namesi
    Name:SLC4A8Imported
    Synonyms:KIAA0739, NBCImported, NBC31 Publication, NDCBE11 Publication
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:11034. SLC4A8.

    Subcellular locationi

    Membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35900.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10931093Electroneutral sodium bicarbonate exchanger 1PRO_0000328922Add
    BLAST

    Proteomic databases

    MaxQBiQ2Y0W8.
    PaxDbiQ2Y0W8.
    PRIDEiQ2Y0W8.

    PTM databases

    PhosphoSiteiQ2Y0W8.

    Expressioni

    Tissue specificityi

    Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed in pancreas and kidney cortex.3 Publications

    Gene expression databases

    ArrayExpressiQ2Y0W8.
    BgeeiQ2Y0W8.
    CleanExiHS_SLC4A8.
    GenevestigatoriQ2Y0W8.

    Organism-specific databases

    HPAiHPA046665.

    Interactioni

    Protein-protein interaction databases

    BioGridi114877. 4 interactions.
    IntActiQ2Y0W8. 1 interaction.
    STRINGi9606.ENSP00000405812.

    Structurei

    3D structure databases

    ProteinModelPortaliQ2Y0W8.
    SMRiQ2Y0W8. Positions 115-398, 462-502.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 478478ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini500 – 52324CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini545 – 56521ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini587 – 5959CytoplasmicSequence Analysis
    Topological domaini617 – 68771ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini709 – 73123CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini753 – 77826ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini800 – 82425CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini846 – 88136ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini903 – 9042CytoplasmicSequence Analysis
    Topological domaini926 – 96237ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini984 – 1093110CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei479 – 49921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei524 – 54421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei566 – 58621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei596 – 61621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei688 – 70821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei732 – 75221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei779 – 79921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei825 – 84521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei882 – 90221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei905 – 92521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei963 – 98321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili1010 – 103627Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the anion exchanger (TC 2.A.31) family. [View classification]Sequence Analysis

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG268067.
    HOGENOMiHOG000280684.
    HOVERGENiHBG004326.
    KOiK13859.
    OMAiVLNIHYE.
    OrthoDBiEOG7TMZR0.
    PhylomeDBiQ2Y0W8.
    TreeFamiTF313630.

    Family and domain databases

    Gene3Di3.40.1100.10. 1 hit.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR003024. Na/HCO3_transpt.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 1 hit.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    PR01232. NAHCO3TRSPRT.
    SUPFAMiSSF55804. SSF55804. 1 hit.
    TIGRFAMsiTIGR00834. ae. 1 hit.

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q2Y0W8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPAAGSNEPD GVLSYQRPDE EAVVDQGGTS TILNIHYEKE ELEGHRTLYV     50
    GVRMPLGRQS HRHHRTHGQK HRRRGRGKGA SQGEEGLEAL AHDTPSQRVQ 100
    FILGTEEDEE HVPHELFTEL DEICMKEGED AEWKETARWL KFEEDVEDGG 150
    ERWSKPYVAT LSLHSLFELR SCLINGTVLL DMHANSIEEI SDLILDQQEL 200
    SSDLNDSMRV KVREALLKKH HHQNEKKRNN LIPIVRSFAE VGKKQSDPHL 250
    MDKHGQTVSP QSVPTTNLEV KNGVNCEHSP VDLSKVDLHF MKKIPTGAEA 300
    SNVLVGEVDI LDRPIVAFVR LSPAVLLSGL TEVPIPTRFL FILLGPVGKG 350
    QQYHEIGRSM ATIMTDEIFH DVAYKAKERD DLLAGIDEFL DQVTVLPPGE 400
    WDPSIRIEPP KNVPSQEKRK MPGVPNGNVC HIEQEPHGGH SGPELQRTGR 450
    LFGGLVLDIK RKAPWYWSDY RDALSLQCLA SFLFLYCACM SPVITFGGLL 500
    GEATEGRISA IESLFGASMT GIAYSLFAGQ ALTILGSTGP VLVFEKILFK 550
    FCKDYALSYL SLRACIGLWT AFLCIVLVAT DASSLVCYIT RFTEEAFASL 600
    ICIIFIYEAI EKLIHLAETY PIHMHSQLDH LSLYYCRCTL PENPNNHTLQ 650
    YWKDHNIVTA EVHWANLTVS ECQEMHGEFM GSACGHHGPY TPDVLFWSCI 700
    LFFTTFILSS TLKTFKTSRY FPTRVRSMVS DFAVFLTIFT MVIIDFLIGV 750
    PSPKLQVPSV FKPTRDDRGW IINPIGPNPW WTVIAAIIPA LLCTILIFMD 800
    QQITAVIINR KEHKLKKGCG YHLDLLMVAI MLGVCSIMGL PWFVAATVLS 850
    ITHVNSLKLE SECSAPGEQP KFLGIREQRV TGLMIFVLMG CSVFMTAILK 900
    FIPMPVLYGV FLYMGVSSLQ GIQFFDRLKL FGMPAKHQPD FIYLRHVPLR 950
    KVHLFTLIQL TCLVLLWVIK ASPAAIVFPM MVLALVFVRK VMDLCFSKRE 1000
    LSWLDDLMPE SKKKKLDDAK KKAKEEEEAE KMLEIGGDKF PLESRKLLSS 1050
    PGKNISCRCD PSEINISDEM PKTTVWKALS MNSGNAKEKS LFN 1093
    Length:1,093
    Mass (Da):122,938
    Last modified:December 20, 2005 - v1
    Checksum:iDDF9D0BC3CBD1A06
    GO
    Isoform 21 Publication (identifier: Q2Y0W8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: MPAAGSNEPDGVLSYQ → MFNKNNSNKLRSTPRYRRGDPGYLNFTELGPLKPEQKDQWSQH
         1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,071
    Mass (Da):120,987
    Checksum:i6CF28C557074A1EE
    GO
    Isoform 31 Publication (identifier: Q2Y0W8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

    Note: May be due to an intron retention.

    Show »
    Length:1,044
    Mass (Da):117,473
    Checksum:i083CF203D4D7FB55
    GO
    Isoform 41 Publication (identifier: Q2Y0W8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.
         1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

    Note: May be due to an intron retention.

    Show »
    Length:991
    Mass (Da):111,661
    Checksum:i41DFC25D0B88F845
    GO
    Isoform 51 Publication (identifier: Q2Y0W8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.

    Show »
    Length:1,040
    Mass (Da):117,126
    Checksum:iA9CB5DD413DCDED7
    GO
    Isoform 61 Publication (identifier: Q2Y0W8-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
         692-1093: Missing.

    Show »
    Length:691
    Mass (Da):77,094
    Checksum:iEACAA9A36A17394B
    GO
    Isoform 7 (identifier: Q2Y0W8-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.
         725-800: VRSMVSDFAV...LLCTILIFMD → MESCSVAWLE...RPPKMLGLQA
         801-1093: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:747
    Mass (Da):83,968
    Checksum:iB02294FA3EB6A40E
    GO
    Isoform 8 (identifier: Q2Y0W8-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.
         671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
         692-1093: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:638
    Mass (Da):71,283
    Checksum:iB8605D6EB82E7098
    GO

    Sequence cautioni

    The sequence BAA34459.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD38576.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti482 – 4821F → L in BAG58292. (PubMed:14702039)Curated
    Sequence conflicti1008 – 10081M → T in AAC82380. (PubMed:11133997)Curated
    Isoform 7 (identifier: Q2Y0W8-7)
    Sequence conflicti707 – 7071Q → R in CAD38576. (PubMed:17974005)Curated
    Sequence conflicti716 – 7161R → G in CAD38576. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti312 – 3121D → A.
    Corresponds to variant rs35966334 [ dbSNP | Ensembl ].
    VAR_048351
    Natural varianti898 – 8981I → V.
    Corresponds to variant rs12318785 [ dbSNP | Ensembl ].
    VAR_048352

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5353Missing in isoform 4, isoform 5, isoform 7 and isoform 8. 3 PublicationsVSP_052759Add
    BLAST
    Alternative sequencei1 – 1616MPAAG…VLSYQ → MFNKNNSNKLRSTPRYRRGD PGYLNFTELGPLKPEQKDQW SQH in isoform 2. 1 PublicationVSP_052760Add
    BLAST
    Alternative sequencei671 – 69121ECQEM…HGPYT → VSLGAARCPSIVTTGLGGTS K in isoform 6 and isoform 8. 2 PublicationsVSP_052761Add
    BLAST
    Alternative sequencei692 – 1093402Missing in isoform 6 and isoform 8. 2 PublicationsVSP_052762Add
    BLAST
    Alternative sequencei725 – 80076VRSMV…LIFMD → MESCSVAWLECGGVILAHCN LRLLPSSWDYRHAPPQPANF CIFSRDGVSPCWPGWSQSLD LVICLPRPPKMLGLQA in isoform 7. 1 PublicationVSP_052763Add
    BLAST
    Alternative sequencei801 – 1093293Missing in isoform 7. 1 PublicationVSP_052764Add
    BLAST
    Alternative sequencei1028 – 109366EAEKM…KSLFN → VIVLAPTVYLGASNYRT in isoform 2, isoform 3 and isoform 4. 3 PublicationsVSP_052765Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF069512 mRNA. Translation: AAC82380.1.
    DQ063579 mRNA. Translation: AAY79176.1.
    DQ975204 mRNA. Translation: ABJ09587.1.
    DQ996537 mRNA. Translation: ABJ91576.1.
    DQ996398 mRNA. Translation: ABJ91577.1.
    AB018282 mRNA. Translation: BAA34459.1. Different initiation.
    AK295315 mRNA. Translation: BAG58292.1.
    AL831915 mRNA. Translation: CAD38576.2. Different initiation.
    AC025097 Genomic DNA. No translation available.
    AC046135 Genomic DNA. No translation available.
    AC107031 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58192.1.
    BC025994 mRNA. Translation: AAH25994.1.
    AF107099 mRNA. Translation: AAD52981.1.
    CCDSiCCDS44890.1. [Q2Y0W8-1]
    CCDS58232.1. [Q2Y0W8-7]
    CCDS58233.1. [Q2Y0W8-8]
    RefSeqiNP_001035049.1. NM_001039960.2. [Q2Y0W8-1]
    NP_001245330.1. NM_001258401.2. [Q2Y0W8-5]
    NP_001245331.1. NM_001258402.1. [Q2Y0W8-6]
    NP_001245332.1. NM_001258403.1. [Q2Y0W8-7]
    NP_001254544.1. NM_001267615.1.
    UniGeneiHs.4749.

    Genome annotation databases

    EnsembliENST00000358657; ENSP00000351483; ENSG00000050438. [Q2Y0W8-2]
    ENST00000453097; ENSP00000405812; ENSG00000050438. [Q2Y0W8-1]
    ENST00000514353; ENSP00000442561; ENSG00000050438. [Q2Y0W8-7]
    ENST00000535225; ENSP00000441520; ENSG00000050438. [Q2Y0W8-8]
    GeneIDi9498.
    KEGGihsa:9498.
    UCSCiuc001rym.4. human. [Q2Y0W8-4]
    uc001ryq.4. human. [Q2Y0W8-6]
    uc001ryr.3. human. [Q2Y0W8-3]
    uc001rys.2. human. [Q2Y0W8-1]
    uc010snj.2. human. [Q2Y0W8-2]

    Polymorphism databases

    DMDMi121942008.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF069512 mRNA. Translation: AAC82380.1 .
    DQ063579 mRNA. Translation: AAY79176.1 .
    DQ975204 mRNA. Translation: ABJ09587.1 .
    DQ996537 mRNA. Translation: ABJ91576.1 .
    DQ996398 mRNA. Translation: ABJ91577.1 .
    AB018282 mRNA. Translation: BAA34459.1 . Different initiation.
    AK295315 mRNA. Translation: BAG58292.1 .
    AL831915 mRNA. Translation: CAD38576.2 . Different initiation.
    AC025097 Genomic DNA. No translation available.
    AC046135 Genomic DNA. No translation available.
    AC107031 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58192.1 .
    BC025994 mRNA. Translation: AAH25994.1 .
    AF107099 mRNA. Translation: AAD52981.1 .
    CCDSi CCDS44890.1. [Q2Y0W8-1 ]
    CCDS58232.1. [Q2Y0W8-7 ]
    CCDS58233.1. [Q2Y0W8-8 ]
    RefSeqi NP_001035049.1. NM_001039960.2. [Q2Y0W8-1 ]
    NP_001245330.1. NM_001258401.2. [Q2Y0W8-5 ]
    NP_001245331.1. NM_001258402.1. [Q2Y0W8-6 ]
    NP_001245332.1. NM_001258403.1. [Q2Y0W8-7 ]
    NP_001254544.1. NM_001267615.1.
    UniGenei Hs.4749.

    3D structure databases

    ProteinModelPortali Q2Y0W8.
    SMRi Q2Y0W8. Positions 115-398, 462-502.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114877. 4 interactions.
    IntActi Q2Y0W8. 1 interaction.
    STRINGi 9606.ENSP00000405812.

    Chemistry

    DrugBanki DB01390. Sodium bicarbonate.

    Protein family/group databases

    TCDBi 2.A.31.2.4. the anion exchanger (ae) family.

    PTM databases

    PhosphoSitei Q2Y0W8.

    Polymorphism databases

    DMDMi 121942008.

    Proteomic databases

    MaxQBi Q2Y0W8.
    PaxDbi Q2Y0W8.
    PRIDEi Q2Y0W8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358657 ; ENSP00000351483 ; ENSG00000050438 . [Q2Y0W8-2 ]
    ENST00000453097 ; ENSP00000405812 ; ENSG00000050438 . [Q2Y0W8-1 ]
    ENST00000514353 ; ENSP00000442561 ; ENSG00000050438 . [Q2Y0W8-7 ]
    ENST00000535225 ; ENSP00000441520 ; ENSG00000050438 . [Q2Y0W8-8 ]
    GeneIDi 9498.
    KEGGi hsa:9498.
    UCSCi uc001rym.4. human. [Q2Y0W8-4 ]
    uc001ryq.4. human. [Q2Y0W8-6 ]
    uc001ryr.3. human. [Q2Y0W8-3 ]
    uc001rys.2. human. [Q2Y0W8-1 ]
    uc010snj.2. human. [Q2Y0W8-2 ]

    Organism-specific databases

    CTDi 9498.
    GeneCardsi GC12P051807.
    HGNCi HGNC:11034. SLC4A8.
    HPAi HPA046665.
    MIMi 605024. gene.
    neXtProti NX_Q2Y0W8.
    PharmGKBi PA35900.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG268067.
    HOGENOMi HOG000280684.
    HOVERGENi HBG004326.
    KOi K13859.
    OMAi VLNIHYE.
    OrthoDBi EOG7TMZR0.
    PhylomeDBi Q2Y0W8.
    TreeFami TF313630.

    Enzyme and pathway databases

    Reactomei REACT_19298. Bicarbonate transporters.

    Miscellaneous databases

    ChiTaRSi SLC4A8. human.
    GeneWikii SLC4A8.
    GenomeRNAii 9498.
    NextBioi 35584.
    PROi Q2Y0W8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q2Y0W8.
    Bgeei Q2Y0W8.
    CleanExi HS_SLC4A8.
    Genevestigatori Q2Y0W8.

    Family and domain databases

    Gene3Di 3.40.1100.10. 1 hit.
    InterProi IPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR003024. Na/HCO3_transpt.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view ]
    PANTHERi PTHR11453. PTHR11453. 1 hit.
    Pfami PF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view ]
    PRINTSi PR01231. HCO3TRNSPORT.
    PR01232. NAHCO3TRSPRT.
    SUPFAMi SSF55804. SSF55804. 1 hit.
    TIGRFAMsi TIGR00834. ae. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, characterization, and chromosomal mapping of a human electroneutral Na(+)-driven Cl-HCO3 exchanger."
      Grichtchenko I.I., Choi I., Zhong X., Bray-Ward P., Russell J.M., Boron W.F.
      J. Biol. Chem. 276:8358-8363(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
      Tissue: Frontal cortexImported.
    2. "An electroneutral Na+-driven Cl-HCO3 exchanger (NDCBE1) with a novel COOH-terminus cloned from human brain."
      Bouyer P., Parker M.D., Boron W.F.
      Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5).
      Tissue: BrainImported and HeartImported.
    3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: BrainImported.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
      Tissue: Caudate nucleus.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Tissue: Amygdala.
    6. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: TestisImported.
    9. "Characterization of Na+/HCO-3 cotransporter isoform NBC-3."
      Amlal H., Burnham C.E., Soleimani M.
      Am. J. Physiol. 276:F903-F913(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-670 (ISOFORMS 1/3/6), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
      Tissue: Testis carcinoma1 Publication.
    10. Erratum
      Amlal H., Burnham C.E., Soleimani M.
      Am. J. Physiol. 277:F477-F477(1999)
    11. "Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues."
      Damkier H.H., Nielsen S., Praetorius J.
      Am. J. Physiol. 293:R2136-R2146(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiS4A8_HUMAN
    AccessioniPrimary (citable) accession number: Q2Y0W8
    Secondary accession number(s): A0MMZ1
    , B4DHY0, E7EML0, F5GZ31, F5H7F5, O94843, O95233, Q004B4, Q8N3U2, Q8TC60, Q9UKX8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: December 20, 2005
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3