Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q2Y0W8 (S4A8_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Electroneutral sodium bicarbonate exchanger 1
Alternative name(s):
Electroneutral Na(+)-driven Cl-HCO3 exchanger
Solute carrier family 4 member 8
k-NBC3
Gene names
Name:SLC4A8
Synonyms:KIAA0739, NBC, NBC3, NDCBE1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1093 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3- exchange with a Na+:HCO3- stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3- from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3- into the cells. Also mediates lithium-dependent HCO3- cotransport. May be regulated by osmolarity. Ref.1 Ref.8 UniProtKB Q8JZR6

Enzyme regulation

Activity is inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

Subcellular location

Membrane; Multi-pass membrane protein Ref.10.

Tissue specificity

Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed in pancreas and kidney cortex. Ref.1 Ref.8 Ref.10

Sequence similarities

Belongs to the anion exchanger (TC 2.A.31) family. [View classification]

Sequence caution

The sequence BAA34459.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAD38576.2 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.2 (identifier: Q2Y0W8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.3 (identifier: Q2Y0W8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MPAAGSNEPDGVLSYQ → MFNKNNSNKLRSTPRYRRGDPGYLNFTELGPLKPEQKDQWSQH
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT
Note: No experimental confirmation available.
Isoform 3 Ref.1 (identifier: Q2Y0W8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT
Note: May be due to an intron retention.
Isoform 4 Ref.2 (identifier: Q2Y0W8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT
Note: May be due to an intron retention.
Isoform 5 Ref.2 (identifier: Q2Y0W8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
Isoform 6 Ref.5 Ref.7 (identifier: Q2Y0W8-6)

The sequence of this isoform differs from the canonical sequence as follows:
     671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
     692-1093: Missing.
Isoform 7 Ref.4 (identifier: Q2Y0W8-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     725-800: VRSMVSDFAV...LLCTILIFMD → MESCSVAWLE...RPPKMLGLQA
     801-1093: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10931093Electroneutral sodium bicarbonate exchanger 1
PRO_0000328922

Regions

Topological domain1 – 478478Extracellular Potential
Transmembrane479 – 49921Helical; Potential
Topological domain500 – 52324Cytoplasmic Potential
Transmembrane524 – 54421Helical; Potential
Topological domain545 – 56521Extracellular Potential
Transmembrane566 – 58621Helical; Potential
Topological domain587 – 5959Cytoplasmic Potential
Transmembrane596 – 61621Helical; Potential
Topological domain617 – 68771Extracellular Potential
Transmembrane688 – 70821Helical; Potential
Topological domain709 – 73123Cytoplasmic Potential
Transmembrane732 – 75221Helical; Potential
Topological domain753 – 77826Extracellular Potential
Transmembrane779 – 79921Helical; Potential
Topological domain800 – 82425Cytoplasmic Potential
Transmembrane825 – 84521Helical; Potential
Topological domain846 – 88136Extracellular Potential
Transmembrane882 – 90221Helical; Potential
Topological domain903 – 9042Cytoplasmic Potential
Transmembrane905 – 92521Helical; Potential
Topological domain926 – 96237Extracellular Potential
Transmembrane963 – 98321Helical; Potential
Topological domain984 – 1093110Cytoplasmic Potential
Coiled coil1010 – 103627 Potential

Natural variations

Alternative sequence1 – 5353Missing in isoform 4, isoform 5 and isoform 7. Ref.2 Ref.4
VSP_052759
Alternative sequence1 – 1616MPAAG…VLSYQ → MFNKNNSNKLRSTPRYRRGD PGYLNFTELGPLKPEQKDQW SQH in isoform 2. Ref.3
VSP_052760
Alternative sequence671 – 69121ECQEM…HGPYT → VSLGAARCPSIVTTGLGGTS K in isoform 6. Ref.5 Ref.7
VSP_052761
Alternative sequence692 – 1093402Missing in isoform 6. Ref.5 Ref.7
VSP_052762
Alternative sequence725 – 80076VRSMV…LIFMD → MESCSVAWLECGGVILAHCN LRLLPSSWDYRHAPPQPANF CIFSRDGVSPCWPGWSQSLD LVICLPRPPKMLGLQA in isoform 7. Ref.4
VSP_052763
Alternative sequence801 – 1093293Missing in isoform 7. Ref.4
VSP_052764
Alternative sequence1028 – 109366EAEKM…KSLFN → VIVLAPTVYLGASNYRT in isoform 2, isoform 3 and isoform 4. Ref.1 Ref.2 Ref.3
VSP_052765
Natural variant3121D → A.
Corresponds to variant rs35966334 [ dbSNP | Ensembl ].
VAR_048351
Natural variant8981I → V.
Corresponds to variant rs12318785 [ dbSNP | Ensembl ].
VAR_048352

Experimental info

Sequence conflict10081M → T in AAC82380. Ref.1
Isoform 7:
Sequence conflict7071Q → R in CAD38576. Ref.4
Sequence conflict7161R → G in CAD38576. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 20, 2005. Version 1.
Checksum: DDF9D0BC3CBD1A06

FASTA1,093122,938
        10         20         30         40         50         60 
MPAAGSNEPD GVLSYQRPDE EAVVDQGGTS TILNIHYEKE ELEGHRTLYV GVRMPLGRQS 

        70         80         90        100        110        120 
HRHHRTHGQK HRRRGRGKGA SQGEEGLEAL AHDTPSQRVQ FILGTEEDEE HVPHELFTEL 

       130        140        150        160        170        180 
DEICMKEGED AEWKETARWL KFEEDVEDGG ERWSKPYVAT LSLHSLFELR SCLINGTVLL 

       190        200        210        220        230        240 
DMHANSIEEI SDLILDQQEL SSDLNDSMRV KVREALLKKH HHQNEKKRNN LIPIVRSFAE 

       250        260        270        280        290        300 
VGKKQSDPHL MDKHGQTVSP QSVPTTNLEV KNGVNCEHSP VDLSKVDLHF MKKIPTGAEA 

       310        320        330        340        350        360 
SNVLVGEVDI LDRPIVAFVR LSPAVLLSGL TEVPIPTRFL FILLGPVGKG QQYHEIGRSM 

       370        380        390        400        410        420 
ATIMTDEIFH DVAYKAKERD DLLAGIDEFL DQVTVLPPGE WDPSIRIEPP KNVPSQEKRK 

       430        440        450        460        470        480 
MPGVPNGNVC HIEQEPHGGH SGPELQRTGR LFGGLVLDIK RKAPWYWSDY RDALSLQCLA 

       490        500        510        520        530        540 
SFLFLYCACM SPVITFGGLL GEATEGRISA IESLFGASMT GIAYSLFAGQ ALTILGSTGP 

       550        560        570        580        590        600 
VLVFEKILFK FCKDYALSYL SLRACIGLWT AFLCIVLVAT DASSLVCYIT RFTEEAFASL 

       610        620        630        640        650        660 
ICIIFIYEAI EKLIHLAETY PIHMHSQLDH LSLYYCRCTL PENPNNHTLQ YWKDHNIVTA 

       670        680        690        700        710        720 
EVHWANLTVS ECQEMHGEFM GSACGHHGPY TPDVLFWSCI LFFTTFILSS TLKTFKTSRY 

       730        740        750        760        770        780 
FPTRVRSMVS DFAVFLTIFT MVIIDFLIGV PSPKLQVPSV FKPTRDDRGW IINPIGPNPW 

       790        800        810        820        830        840 
WTVIAAIIPA LLCTILIFMD QQITAVIINR KEHKLKKGCG YHLDLLMVAI MLGVCSIMGL 

       850        860        870        880        890        900 
PWFVAATVLS ITHVNSLKLE SECSAPGEQP KFLGIREQRV TGLMIFVLMG CSVFMTAILK 

       910        920        930        940        950        960 
FIPMPVLYGV FLYMGVSSLQ GIQFFDRLKL FGMPAKHQPD FIYLRHVPLR KVHLFTLIQL 

       970        980        990       1000       1010       1020 
TCLVLLWVIK ASPAAIVFPM MVLALVFVRK VMDLCFSKRE LSWLDDLMPE SKKKKLDDAK 

      1030       1040       1050       1060       1070       1080 
KKAKEEEEAE KMLEIGGDKF PLESRKLLSS PGKNISCRCD PSEINISDEM PKTTVWKALS 

      1090 
MNSGNAKEKS LFN 

« Hide

Isoform 2 [UniParc].

Checksum: 6CF28C557074A1EE
Show »

FASTA1,071120,987
Isoform 3 [UniParc].

Checksum: 083CF203D4D7FB55
Show »

FASTA1,044117,473
Isoform 4 [UniParc].

Checksum: 41DFC25D0B88F845
Show »

FASTA991111,661
Isoform 5 [UniParc].

Checksum: A9CB5DD413DCDED7
Show »

FASTA1,040117,126
Isoform 6 [UniParc].

Checksum: EACAA9A36A17394B
Show »

FASTA69177,094
Isoform 7 [UniParc].

Checksum: B02294FA3EB6A40E
Show »

FASTA74783,968

References

« Hide 'large scale' references
[1]"Cloning, characterization, and chromosomal mapping of a human electroneutral Na(+)-driven Cl-HCO3 exchanger."
Grichtchenko I.I., Choi I., Zhong X., Bray-Ward P., Russell J.M., Boron W.F.
J. Biol. Chem. 276:8358-8363(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
Tissue: Frontal cortex.
[2]"An electroneutral Na+-driven Cl-HCO3 exchanger (NDCBE1) with a novel COOH-terminus cloned from human brain."
Bouyer P., Parker M.D., Boron W.F.
Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5).
Tissue: Brain and Heart.
[3]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
Tissue: Amygdala.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Testis.
[8]"Characterization of Na+/HCO-3 cotransporter isoform NBC-3."
Amlal H., Burnham C.E., Soleimani M.
Am. J. Physiol. 276:F903-F913(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-670 (ISOFORMS 1/3/6), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
Tissue: Testis carcinoma.
[9]Erratum
Amlal H., Burnham C.E., Soleimani M.
Am. J. Physiol. 277:F477-F477(1999)
[10]"Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues."
Damkier H.H., Nielsen S., Praetorius J.
Am. J. Physiol. 293:R2136-R2146(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[11]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF069512 mRNA. Translation: AAC82380.1.
DQ063579 mRNA. Translation: AAY79176.1.
DQ975204 mRNA. Translation: ABJ09587.1.
DQ996537 mRNA. Translation: ABJ91576.1.
DQ996398 mRNA. Translation: ABJ91577.1.
AB018282 mRNA. Translation: BAA34459.1. Different initiation.
AL831915 mRNA. Translation: CAD38576.2. Different initiation.
AC025097 Genomic DNA. No translation available.
AC046135 Genomic DNA. No translation available.
AC107031 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58192.1.
BC025994 mRNA. Translation: AAH25994.1.
AF107099 mRNA. Translation: AAD52981.1.
RefSeqNP_001035049.1. NM_001039960.2.
NP_001245330.1. NM_001258401.2.
NP_001245331.1. NM_001258402.1.
NP_001245332.1. NM_001258403.1.
NP_001254544.1. NM_001267615.1.
UniGeneHs.4749.

3D structure databases

ProteinModelPortalQ2Y0W8.
SMRQ2Y0W8. Positions 115-398, 462-502, 922-954.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114877. 4 interactions.
IntActQ2Y0W8. 1 interaction.
STRING9606.ENSP00000405812.

Protein family/group databases

TCDB2.A.31.2.4. the anion exchanger (ae) family.

PTM databases

PhosphoSiteQ2Y0W8.

Polymorphism databases

DMDM121942008.

Proteomic databases

PaxDbQ2Y0W8.
PRIDEQ2Y0W8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358657; ENSP00000351483; ENSG00000050438. [Q2Y0W8-2]
ENST00000394856; ENSP00000378325; ENSG00000050438.
ENST00000453097; ENSP00000405812; ENSG00000050438. [Q2Y0W8-1]
ENST00000514353; ENSP00000442561; ENSG00000050438.
GeneID9498.
KEGGhsa:9498.
UCSCuc001rym.4. human. [Q2Y0W8-4]
uc001ryq.4. human. [Q2Y0W8-6]
uc001ryr.3. human. [Q2Y0W8-3]
uc001rys.2. human. [Q2Y0W8-1]
uc010snj.2. human. [Q2Y0W8-2]

Organism-specific databases

CTD9498.
GeneCardsGC12P051807.
HGNCHGNC:11034. SLC4A8.
HPAHPA046665.
MIM605024. gene.
neXtProtNX_Q2Y0W8.
PharmGKBPA35900.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG268067.
HOVERGENHBG004326.
KOK13859.
OMAVLNIHYE.
OrthoDBEOG7TMZR0.
PhylomeDBQ2Y0W8.
TreeFamTF313630.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ2Y0W8.
BgeeQ2Y0W8.
CleanExHS_SLC4A8.
GenevestigatorQ2Y0W8.

Family and domain databases

Gene3D3.40.1100.10. 1 hit.
InterProIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERPTHR11453. PTHR11453. 1 hit.
PfamPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSPR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMSSF55804. SSF55804. 1 hit.
TIGRFAMsTIGR00834. ae. 1 hit.
ProtoNetSearch...

Other

ChiTaRSSLC4A8. human.
GeneWikiSLC4A8.
GenomeRNAi9498.
NextBio35584.
PROQ2Y0W8.
SOURCESearch...

Entry information

Entry nameS4A8_HUMAN
AccessionPrimary (citable) accession number: Q2Y0W8
Secondary accession number(s): A0MMZ1 expand/collapse secondary AC list , E7EML0, F5H7F5, O94843, O95233, Q004B4, Q8N3U2, Q8TC60, Q9UKX8
Entry history
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: December 20, 2005
Last modified: April 16, 2014
This is version 82 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM