Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MLX-interacting protein

Gene

Mlxip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds DNA as a heterodimer with MLX and activates transcription. Binds to the canonical E box sequence 5'-CACGTG-3'. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
MLX-interacting protein
Alternative name(s):
Transcriptional activator MondoA
Gene namesi
Name:MlxipImported
Synonyms:MirImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2141183. Mlxip.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus PROSITE-ProRule annotation1 Publication
  • Mitochondrion outer membrane 1 Publication

  • Note: Predominantly cytoplasmic but shuttles between cytoplasm and nucleus when associated with MLX. Also associates with the outer mitochondrial membrane and may shuttle between the outer mitochondrial membrane and the nucleus.By similarity1 Publication

GO - Cellular componenti

  • cytoplasm Source: MGI
  • mitochondrial outer membrane Source: UniProtKB-SubCell
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 917916MLX-interacting proteinPRO_0000298764Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity
Modified residuei9 – 91PhosphoserineBy similarity
Modified residuei33 – 331PhosphoserineBy similarity
Modified residuei39 – 391PhosphoserineCombined sources
Modified residuei667 – 6671PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ2VPU4.
PaxDbiQ2VPU4.
PRIDEiQ2VPU4.

PTM databases

iPTMnetiQ2VPU4.
PhosphoSiteiQ2VPU4.

Expressioni

Developmental stagei

Broadly expressed from 9.5 dpc to at least 15 dpc, with slightly elevated levels in the developing nervous system.1 Publication

Gene expression databases

CleanExiMM_MLXIP.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a homodimer or a heterodimer with MLX.1 Publication

Protein-protein interaction databases

BioGridi228948. 2 interactions.
STRINGi10090.ENSMUSP00000064943.

Structurei

3D structure databases

ProteinModelPortaliQ2VPU4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini717 – 76751bHLHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni73 – 327255Required for cytoplasmic localizationBy similarityAdd
BLAST
Regioni322 – 445124Transactivation domain1 PublicationAdd
BLAST
Regioni767 – 78822Leucine-zipperAdd
BLAST
Regioni830 – 87950Mediates heterotypic interactions between MLXIP and MLX and is required for cytoplasmic localizationBy similarityAdd
BLAST

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3582. Eukaryota.
ENOG410XTA5. LUCA.
HOGENOMiHOG000113606.
HOVERGENiHBG062003.
InParanoidiQ2VPU4.
KOiK09113.
PhylomeDBiQ2VPU4.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR032648. MLXIP.
[Graphical view]
PANTHERiPTHR15741:SF23. PTHR15741:SF23. 1 hit.
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q2VPU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAADVFMCSP RRPRSRGRSV LLKPQVPEDD DDSDTDEPSP PPPSGVATSA
60 70 80 90 100
RAHASAAPLP PRAGPGREEP PRRQQIIHSG HFMVSSPHRE HPPKKGYDFD
110 120 130 140 150
TVNKQTCQTY SFGKTSSCHL SIDASLTKLF ECMTLAYSGK LVSPKWKNFK
160 170 180 190 200
GLKLQWRDKI RLNNAIWRAW YMQYLEKRRN PVCHFVTPLD GSVDVDEHRR
210 220 230 240 250
PEAITTEGKY WKSRIEIVIR EYHKWRTYFK KRLQQHKDED LSSLAQDDDM
260 270 280 290 300
LYWHKHGDGW KTPVPMEEDS LLDTDMLMSE FSDTLFSTLS SHQPVAWPNP
310 320 330 340 350
REIAHLGNAD MIQPGLIPLQ PNLDFMDTFE PFQDLFSSSR SIFGSMLPPP
360 370 380 390 400
SSLPAADPSS PPSQGNILPN TALPPASLPN SLITSSAAPS LDPTEGQGCE
410 420 430 440 450
RTSQTVDPFI QPADFGPSEP PLSVPQPFLP VFTMTLLSPG PAPAPVPTAL
460 470 480 490 500
PLVPSPAPTL NPPTPPAFLQ PQKFAGVSKS TPVITHTASA TLTHDASATT
510 520 530 540 550
FSQNQGLVIT AHHPTPSSSP CALALSPVPQ PPAVGPPQPH LTFIHPKPVS
560 570 580 590 600
LTGVRHKQPP KIVPAPKPEP VSLVLKNACI APAAFSGQPQ KVIMTSAPLK
610 620 630 640 650
REGILASTVS PSNVVIASAA ITRASGVTEF LSHSTSSQPS PVSRLFSPST
660 670 680 690 700
VQDSLVKGEQ VSLHGGSPQV PATGSSRDCP NSGQASPCPS EQSPSPQSPQ
710 720 730 740 750
NNCSGKSTDP KNVAALKNRQ KHISAEQKRR FNIRMGFNTL NSLISNNSKQ
760 770 780 790 800
TSHAITLQKT MEYITKLQQE RMQMQEEARR LREEIEELNT TIISCQQLLP
810 820 830 840 850
ATGVPVNCRQ LDHMRDMFDE YVKSRTLQNW KFWIFSMIIK PLFESFKGMV
860 870 880 890 900
STSSLEEFHR TALSWLDQHC SLPVLRPMVL STLRQLSTTT SILTDPSQLP
910
EQASEAVTRM GKRSGES
Length:917
Mass (Da):100,804
Last modified:January 10, 2006 - v1
Checksum:i2944C041E78F89FC
GO
Isoform 21 Publication (identifier: Q2VPU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     583-614: AAFSGQPQKVIMTSAPLKREGILASTVSPSNV → GELVGGVVSQNCLGSNVSLSLRLYIGKNSLPT
     615-917: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:614
Mass (Da):67,085
Checksum:iB72C6C2905A8EA3E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti179 – 1791R → K in BAC33069 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei583 – 61432AAFSG…SPSNV → GELVGGVVSQNCLGSNVSLS LRLYIGKNSLPT in isoform 2. 1 PublicationVSP_052505Add
BLAST
Alternative sequencei615 – 917303Missing in isoform 2. 1 PublicationVSP_052506Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY968204 mRNA. Translation: AAY41069.1.
AK047475 mRNA. Translation: BAC33069.1.
BC060733 mRNA. Translation: AAH60733.1.
BC067045 mRNA. Translation: AAH67045.1.
AF265663 mRNA. Translation: AAL55724.1.
CCDSiCCDS19662.1. [Q2VPU4-1]
CCDS39268.1. [Q2VPU4-2]
RefSeqiNP_598678.2. NM_133917.3.
NP_808250.1. NM_177582.3.
UniGeneiMm.83277.

Genome annotation databases

GeneIDi208104.
KEGGimmu:208104.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY968204 mRNA. Translation: AAY41069.1.
AK047475 mRNA. Translation: BAC33069.1.
BC060733 mRNA. Translation: AAH60733.1.
BC067045 mRNA. Translation: AAH67045.1.
AF265663 mRNA. Translation: AAL55724.1.
CCDSiCCDS19662.1. [Q2VPU4-1]
CCDS39268.1. [Q2VPU4-2]
RefSeqiNP_598678.2. NM_133917.3.
NP_808250.1. NM_177582.3.
UniGeneiMm.83277.

3D structure databases

ProteinModelPortaliQ2VPU4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228948. 2 interactions.
STRINGi10090.ENSMUSP00000064943.

PTM databases

iPTMnetiQ2VPU4.
PhosphoSiteiQ2VPU4.

Proteomic databases

MaxQBiQ2VPU4.
PaxDbiQ2VPU4.
PRIDEiQ2VPU4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi208104.
KEGGimmu:208104.

Organism-specific databases

CTDi22877.
MGIiMGI:2141183. Mlxip.

Phylogenomic databases

eggNOGiKOG3582. Eukaryota.
ENOG410XTA5. LUCA.
HOGENOMiHOG000113606.
HOVERGENiHBG062003.
InParanoidiQ2VPU4.
KOiK09113.
PhylomeDBiQ2VPU4.

Miscellaneous databases

PROiQ2VPU4.
SOURCEiSearch...

Gene expression databases

CleanExiMM_MLXIP.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR032648. MLXIP.
[Graphical view]
PANTHERiPTHR15741:SF23. PTHR15741:SF23. 1 hit.
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMLXIP_MOUSE
AccessioniPrimary (citable) accession number: Q2VPU4
Secondary accession number(s): Q6NXJ4
, Q6P9J8, Q8C8C6, Q8VI53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: January 10, 2006
Last modified: July 6, 2016
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.