Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

Cd163

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 (By similarity).By similarity
After shedding, the soluble form (sCD163) may play an anti-inflammatory role.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Acute phase, Inflammatory response

Enzyme and pathway databases

ReactomeiR-MMU-2168880. Scavenging of heme from plasma.

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
Gene namesi
Name:Cd163
Synonyms:M130
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2135946. Cd163.

Subcellular locationi

Soluble CD163 :
  • Secreted By similarity
  • Cell membrane By similarity; Single-pass type I membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini39 – 10451007ExtracellularSequence analysisAdd
BLAST
Transmembranei1046 – 106621HelicalSequence analysisAdd
BLAST
Topological domaini1067 – 112155CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3838Sequence analysisAdd
BLAST
Chaini39 – 11211083Scavenger receptor cysteine-rich type 1 protein M130PRO_0000238940Add
BLAST
Chaini39 – ?Soluble CD163PRO_0000238941

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi75 ↔ 139PROSITE-ProRule annotation
Disulfide bondi88 ↔ 149PROSITE-ProRule annotation
Glycosylationi104 – 1041N-linked (GlcNAc...)Sequence analysis
Disulfide bondi119 ↔ 129PROSITE-ProRule annotation
Glycosylationi138 – 1381N-linked (GlcNAc...)Sequence analysis
Disulfide bondi183 ↔ 247PROSITE-ProRule annotation
Disulfide bondi196 ↔ 257PROSITE-ProRule annotation
Disulfide bondi227 ↔ 237PROSITE-ProRule annotation
Disulfide bondi290 ↔ 354PROSITE-ProRule annotation
Disulfide bondi303 ↔ 364PROSITE-ProRule annotation
Disulfide bondi334 ↔ 344PROSITE-ProRule annotation
Disulfide bondi397 ↔ 461PROSITE-ProRule annotation
Disulfide bondi410 ↔ 471PROSITE-ProRule annotation
Disulfide bondi441 ↔ 451PROSITE-ProRule annotation
Disulfide bondi502 ↔ 566PROSITE-ProRule annotation
Disulfide bondi515 ↔ 576PROSITE-ProRule annotation
Disulfide bondi546 ↔ 556PROSITE-ProRule annotation
Disulfide bondi607 ↔ 671PROSITE-ProRule annotation
Disulfide bondi620 ↔ 681PROSITE-ProRule annotation
Disulfide bondi651 ↔ 661PROSITE-ProRule annotation
Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
Disulfide bondi864 ↔ 926PROSITE-ProRule annotation
Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
Disulfide bondi955 ↔ 1019PROSITE-ProRule annotation
Disulfide bondi968 ↔ 1029PROSITE-ProRule annotation
Disulfide bondi999 ↔ 1009PROSITE-ProRule annotation

Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ2VLH6.
MaxQBiQ2VLH6.
PaxDbiQ2VLH6.
PRIDEiQ2VLH6.

PTM databases

iPTMnetiQ2VLH6.
PhosphoSiteiQ2VLH6.
SwissPalmiQ2VLH6.

Expressioni

Tissue specificityi

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen and mesenteric lymph nodes.1 Publication

Inductioni

Induced by antiinflammatory mediators such as glucocorticoids and IL10; suppressed by IL4.1 Publication

Gene expression databases

BgeeiQ2VLH6.
CleanExiMM_CD163.
ExpressionAtlasiQ2VLH6. baseline and differential.
GenevisibleiQ2VLH6. MM.

Interactioni

Subunit structurei

Interacts with CSNK2B.By similarity

Protein-protein interaction databases

IntActiQ2VLH6. 1 interaction.
MINTiMINT-4124450.
STRINGi10090.ENSMUSP00000108160.

Structurei

3D structure databases

ProteinModelPortaliQ2VLH6.
SMRiQ2VLH6. Positions 47-365, 370-1036.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 150101SRCR 1PROSITE-ProRule annotationAdd
BLAST
Domaini157 – 258102SRCR 2PROSITE-ProRule annotationAdd
BLAST
Domaini265 – 365101SRCR 3PROSITE-ProRule annotationAdd
BLAST
Domaini372 – 472101SRCR 4PROSITE-ProRule annotationAdd
BLAST
Domaini477 – 577101SRCR 5PROSITE-ProRule annotationAdd
BLAST
Domaini582 – 682101SRCR 6PROSITE-ProRule annotationAdd
BLAST
Domaini719 – 819101SRCR 7PROSITE-ProRule annotationAdd
BLAST
Domaini824 – 927104SRCR 8PROSITE-ProRule annotationAdd
BLAST
Domaini930 – 1030101SRCR 9PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1091 – 10944Internalization signal

Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.By similarity

Sequence similaritiesi

Contains 9 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHBC. Eukaryota.
ENOG410XQVR. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000290652.
HOVERGENiHBG080943.
InParanoidiQ2VLH6.
KOiK06545.
OMAiKLIGKVC.
OrthoDBiEOG7RNK07.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 9 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 9 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 9 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 9 hits.
PROSITEiPS00420. SRCR_1. 3 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2VLH6-1) [UniParc]FASTAAdd to basket

Also known as: CD163v2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGHRMVLLG GAGSPGCKRF VHLGFFVVAV SSLLSASAVT NAPGEMKKEL
60 70 80 90 100
RLAGGENNCS GRVELKIHDK WGTVCSNGWS MNEVSVVCQQ LGCPTSIKAL
110 120 130 140 150
GWANSSAGSG YIWMDKVSCT GNESALWDCK HDGWGKHNCT HEKDAGVTCS
160 170 180 190 200
DGSNLEMRLV NSAGHRCLGR VEIKFQGKWG TVCDDNFSKD HASVICKQLG
210 220 230 240 250
CGSAISFSGS AKLGAGSGPI WLDDLACNGN ESALWDCKHR GWGKHNCDHA
260 270 280 290 300
EDVGVICLEG ADLSLRLVDG VSRCSGRLEV RFQGEWGTVC DDNWDLRDAS
310 320 330 340 350
VVCKQLGCPT AISAIGRVNA SEGSGQIWLD NISCEGHEAT LWECKHQEWG
360 370 380 390 400
KHYCHHREDA GVTCSDGADL ELRLVGGGSR CAGIVEVEIQ KLTGKMCSRG
410 420 430 440 450
WTLADADVVC RQLGCGSALQ TQAKIYSKTG ATNTWLFPGS CNGNETTFWQ
460 470 480 490 500
CKNWQWGGLS CDNFEEAKVT CSGHREPRLV GGEIPCSGRV EVKHGDVWGS
510 520 530 540 550
VCDFDLSLEA ASVVCRELQC GTVVSILGGA HFGEGSGQIW GEEFQCSGDE
560 570 580 590 600
SHLSLCSVAP PLDRTCTHSR DVSVVCSRYI DIRLAGGESS CEGRVELKTL
610 620 630 640 650
GAWGPLCSSH WDMEDAHVLC QQLKCGVAQS IPEGAHFGKG AGQVWSHMFH
660 670 680 690 700
CTGTEEHIGD CLMTALGAPT CSEGQVASVI CSGNQSQTLL PCSSLSPVQT
710 720 730 740 750
TSSTIPKESE VPCIASGQLR LVGGGGRCAG RVEVYHEGSW GTVCDDNWDM
760 770 780 790 800
TDANVVCKQL DCGVAINATG SAYFGEGAGA IWLDEVICTG KESHIWQCHS
810 820 830 840 850
HGWGRHNCRH KEDAGVICSE FMSLRLTNEA HKENCTGRLE VFYNGTWGSI
860 870 880 890 900
GSSNMSPTTV GVVCRQLGCA DNGTVKPIPS DKTPSRPMWV DRVQCPKGVD
910 920 930 940 950
TLWQCPSSPW KQRQASPSSQ ESWIICDNKI RLQEGHTDCS GRVEIWHKGS
960 970 980 990 1000
WGTVCDDSWD LNDAKVVCKQ LGCGQAVKAL KEAAFGPGTG PIWLNEIKCR
1010 1020 1030 1040 1050
GNESSLWDCP AKPWSHSDCG HKEDASIQCL PKMTSESHHG TGHPTLTALL
1060 1070 1080 1090 1100
VCGAILLVLL IVFLLWTLKR RQIQRLTVSS RGEVLIHQVQ YQEMDSKADD
1110 1120
LDLLKSSGVI QRHTEKENDN L
Length:1,121
Mass (Da):120,921
Last modified:July 27, 2011 - v2
Checksum:i553B1EF5ED5064BD
GO
Isoform 2 (identifier: Q2VLH6-2) [UniParc]FASTAAdd to basket

Also known as: CD163v3

The sequence of this isoform differs from the canonical sequence as follows:
     1108-1121: GVIQRHTEKENDNL → ENSNNSYDFNDDGLTSLSKYLPISGIKKGSFRGTLRRKMIIYNPLRLEFKKP

Show »
Length:1,159
Mass (Da):125,292
Checksum:iF7FFA963E4277CC1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti492 – 4921V → M in AAY99764 (Ref. 2) Curated
Sequence conflicti735 – 7351Y → C in AAK16065 (PubMed:11345593).Curated
Sequence conflicti834 – 8341N → S in AAY99763 (Ref. 2) Curated
Sequence conflicti950 – 9501S → F in AAY99763 (Ref. 2) Curated
Sequence conflicti1072 – 10721Q → R in AAK16065 (PubMed:11345593).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1108 – 112114GVIQR…ENDNL → ENSNNSYDFNDDGLTSLSKY LPISGIKKGSFRGTLRRKMI IYNPLRLEFKKP in isoform 2. 1 PublicationVSP_019016Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274883 mRNA. Translation: AAK16065.1.
DQ058616 mRNA. Translation: AAY99763.1.
DQ058617 mRNA. Translation: AAY99764.1.
CH466523 Genomic DNA. Translation: EDK99729.1.
BC145793 mRNA. Translation: AAI45794.1.
CCDSiCCDS20516.1. [Q2VLH6-1]
CCDS51905.1. [Q2VLH6-2]
RefSeqiNP_444324.2. NM_053094.2. [Q2VLH6-1]
UniGeneiMm.37426.

Genome annotation databases

EnsembliENSMUST00000032234; ENSMUSP00000032234; ENSMUSG00000008845. [Q2VLH6-1]
ENSMUST00000112541; ENSMUSP00000108160; ENSMUSG00000008845. [Q2VLH6-2]
GeneIDi93671.
KEGGimmu:93671.
UCSCiuc009dqn.2. mouse. [Q2VLH6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274883 mRNA. Translation: AAK16065.1.
DQ058616 mRNA. Translation: AAY99763.1.
DQ058617 mRNA. Translation: AAY99764.1.
CH466523 Genomic DNA. Translation: EDK99729.1.
BC145793 mRNA. Translation: AAI45794.1.
CCDSiCCDS20516.1. [Q2VLH6-1]
CCDS51905.1. [Q2VLH6-2]
RefSeqiNP_444324.2. NM_053094.2. [Q2VLH6-1]
UniGeneiMm.37426.

3D structure databases

ProteinModelPortaliQ2VLH6.
SMRiQ2VLH6. Positions 47-365, 370-1036.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ2VLH6. 1 interaction.
MINTiMINT-4124450.
STRINGi10090.ENSMUSP00000108160.

PTM databases

iPTMnetiQ2VLH6.
PhosphoSiteiQ2VLH6.
SwissPalmiQ2VLH6.

Proteomic databases

EPDiQ2VLH6.
MaxQBiQ2VLH6.
PaxDbiQ2VLH6.
PRIDEiQ2VLH6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032234; ENSMUSP00000032234; ENSMUSG00000008845. [Q2VLH6-1]
ENSMUST00000112541; ENSMUSP00000108160; ENSMUSG00000008845. [Q2VLH6-2]
GeneIDi93671.
KEGGimmu:93671.
UCSCiuc009dqn.2. mouse. [Q2VLH6-1]

Organism-specific databases

CTDi9332.
MGIiMGI:2135946. Cd163.

Phylogenomic databases

eggNOGiENOG410IHBC. Eukaryota.
ENOG410XQVR. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000290652.
HOVERGENiHBG080943.
InParanoidiQ2VLH6.
KOiK06545.
OMAiKLIGKVC.
OrthoDBiEOG7RNK07.
TreeFamiTF329295.

Enzyme and pathway databases

ReactomeiR-MMU-2168880. Scavenging of heme from plasma.

Miscellaneous databases

PROiQ2VLH6.
SOURCEiSearch...

Gene expression databases

BgeeiQ2VLH6.
CleanExiMM_CD163.
ExpressionAtlasiQ2VLH6. baseline and differential.
GenevisibleiQ2VLH6. MM.

Family and domain databases

Gene3Di3.10.250.10. 9 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 9 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 9 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 9 hits.
PROSITEiPS00420. SRCR_1. 3 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of the mouse CD163 homologue, a highly glucocorticoid-inducible member of the scavenger receptor cysteine-rich family."
    Schaer D.J., Boretti F.S., Hongegger A., Poehler D., Linnscheid P., Staege H., Mueller C., Schoedon G., Schaffner A.
    Immunogenetics 53:170-177(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, TISSUE SPECIFICITY.
  2. "Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses."
    Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: BALB/cJ.
  3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Brain.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brown adipose tissue, Heart, Liver, Lung, Pancreas and Spleen.

Entry informationi

Entry nameiC163A_MOUSE
AccessioniPrimary (citable) accession number: Q2VLH6
Secondary accession number(s): A6H691, Q2VLH5, Q99MX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: July 27, 2011
Last modified: July 6, 2016
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.