Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative eukaryotic translation initiation factor 2 subunit 3-like protein

Gene

EIF2S3L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein uncertaini

Functioni

As a subunit of eukaryotic initiation factor 2 (eIF2), involved in the early steps of protein synthesis. In the presence of GTP, eIF2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex, a step that determines the rate of protein translation. This step is followed by mRNA binding to form the 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF2 and release of an eIF2-GDP binary complex. In order for eIF2 to recycle and catalyze another round of initiation, the GDP bound to eIF2 must exchange with GTP by way of a reaction catalyzed by eIF2B (By similarity). Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).By similarity

Caution

Could be the product of a pseudogene. Evidence for transcription scarce. To the best of our knowledge, peptides that have been sequenced so far and that were identical to the canonical sequence displayed in this entry are common to both EIF2S3 and EIF2S3L and thus do not allow to discriminate both proteins. Protein sequence data have been included in EIF2S3 entry.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi48 – 55GTPBy similarity8
Nucleotide bindingi134 – 138GTPBy similarity5
Nucleotide bindingi190 – 193GTPBy similarity4

GO - Molecular functioni

Keywordsi

Molecular functionInitiation factor
Biological processProtein biosynthesis
LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Putative eukaryotic translation initiation factor 2 subunit 3-like protein
Alternative name(s):
Eukaryotic translation initiation factor 2 subunit gamma A
Short name:
eIF-2-gamma A1 Publication
Short name:
eIF-2gA
Gene namesi
Name:EIF2S3L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

EuPathDBiHostDB:ENSG00000180574.3
neXtProtiNX_Q2VIR3

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180574

Polymorphism and mutation databases

DMDMi205830883

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00003439412 – 472Putative eukaryotic translation initiation factor 2 subunit 3-like proteinAdd BLAST471

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei16PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ2VIR3
MaxQBiQ2VIR3
PaxDbiQ2VIR3
PeptideAtlasiQ2VIR3
PRIDEiQ2VIR3

PTM databases

SwissPalmiQ2VIR3

Expressioni

Tissue specificityi

Specifically expressed in testis at the mRNA level.1 Publication

Gene expression databases

BgeeiENSG00000180574
ExpressionAtlasiQ2VIR3 baseline and differential
GenevisibleiQ2VIR3 HS

Interactioni

Subunit structurei

The eukaryotic translation initiation factor 2 complex/eIF2 is a heterotrimer composed of an alpha, a beta and a gamma subunit.By similarity

Protein-protein interaction databases

IntActiQ2VIR3, 3 interactors
MINTiQ2VIR3
STRINGi9606.ENSP00000445077

Structurei

3D structure databases

ProteinModelPortaliQ2VIR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini39 – 248tr-type GPROSITE-ProRule annotationAdd BLAST210

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni48 – 55G1PROSITE-ProRule annotation8
Regioni76 – 80G2PROSITE-ProRule annotation5
Regioni134 – 137G3PROSITE-ProRule annotation4
Regioni190 – 193G4PROSITE-ProRule annotation4
Regioni225 – 227G5PROSITE-ProRule annotation3

Sequence similaritiesi

Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EIF2G subfamily.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0466 Eukaryota
COG5257 LUCA
GeneTreeiENSGT00550000074801
HOGENOMiHOG000229292
HOVERGENiHBG006123
InParanoidiQ2VIR3
OrthoDBiEOG091G0624
PhylomeDBiQ2VIR3

Family and domain databases

CDDicd15490 eIF2_gamma_III, 1 hit
InterProiView protein in InterPro
IPR004161 EFTu-like_2
IPR027417 P-loop_NTPase
IPR000795 TF_GTP-bd_dom
IPR015256 TIF2_gsu_C
IPR009000 Transl_B-barrel_sf
IPR009001 Transl_elong_EF1A/Init_IF2_C
PfamiView protein in Pfam
PF09173 eIF2_C, 1 hit
PF00009 GTP_EFTU, 1 hit
PF03144 GTP_EFTU_D2, 1 hit
PRINTSiPR00315 ELONGATNFCT
SUPFAMiSSF50447 SSF50447, 1 hit
SSF50465 SSF50465, 1 hit
SSF52540 SSF52540, 2 hits
PROSITEiView protein in PROSITE
PS51722 G_TR_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2VIR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGGEAGVTL GQPHLSRQDL TTLDVTKLTP LSHEVISRQA TINIGTIGHV
60 70 80 90 100
AHGKSTVVKA ISGVHTVRFK NELERNITIK LGYANAKIYQ LDDPSCPRPE
110 120 130 140 150
CYRSCGSSMP DEFPTDIPGT KGNFRLVRHV SFVDCPGHDI LMATMLNGAA
160 170 180 190 200
VMDAALLLIA GNESCPQPQT SEHLAAIEIM KLKHILILQN KIDLVKERQA
210 220 230 240 250
KEQYEQILAF VQGTVAEGAP IIPISAQLKY NIEVVCEYIV KKIPVPPRDF
260 270 280 290 300
TSEPRLIVIR SFDVNKPGCE VDDLKGGVAG GSILKGVLKV GQETEVRPGI
310 320 330 340 350
VSKDSEGKLM CKSIFSKIVS LFAEHNDLQY AAPGGLIGVG TKIDPTLCRA
360 370 380 390 400
DRMVGQILGA VGALPEIFTE LEISYFLLRR LLGVRTEGDK KAAKVQKLSK
410 420 430 440 450
NEVLMVNIGS LSTGGRVSAV KADLGKIVLT NPVCTEVGEK IALSRRVEKH
460 470
WRLIGWGQIR RGVTIKPTVD DD
Note: No experimental confirmation available.
Length:472
Mass (Da):51,229
Last modified:July 22, 2008 - v2
Checksum:i6ECFD47900903ED9
GO
Isoform 2 (identifier: Q2VIR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-472: VGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD → IHLIHLDLIKELEWGPLLTNETQRKSAANF

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):50,544
Checksum:i8B418E91C29E7045
GO

Sequence cautioni

The sequence ABB92405 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAA07331 differs from that shown. Reason: Frameshift at position 304.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti243I → F in ABB92405 (PubMed:16201836).Curated1
Sequence conflicti258V → G in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti279A → T in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti292Q → H in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti300I → L in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti313S → P in ABB92405 (PubMed:16201836).Curated1
Sequence conflicti313S → P in AAH87847 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034711437 – 472VGEKI…TVDDD → IHLIHLDLIKELEWGPLLTN ETQRKSAANF in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ120619 Genomic DNA Translation: ABB92405.1 Sequence problems.
AC068775 Genomic DNA No translation available.
BC087847 mRNA Translation: AAH87847.1
AJ006932 Genomic DNA Translation: CAA07331.1 Frameshift.
UniGeneiHs.539684
Hs.547382

Genome annotation databases

UCSCiuc058lel.1 human [Q2VIR3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIF2GL_HUMAN
AccessioniPrimary (citable) accession number: Q2VIR3
Secondary accession number(s): Q5I0X0, Q6KF84
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: May 23, 2018
This is version 99 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health