Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CBL-interacting serine/threonine-protein kinase 3

Gene

CIPK3

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the resistance to some abiotic stresses (e.g. high salt, hyperosmotic stress) in young seedlings, by regulating the expression of several stress-inducible genes (cold- and salt-induced genes but not drought-responsive genes). Required for the ABA response during germination. CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner. The CBL9/CIPK3 complex acts in the regulation of abscisic acid response in seed germination.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mn2+By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei43 – 431ATPPROSITE-ProRule annotation
Active sitei137 – 1371Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi20 – 289ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Manganese, Nucleotide-binding

Enzyme and pathway databases

BioCyciARA:AT2G26980-MONOMER.
ARA:GQT-1408-MONOMER.
ARA:GQT-1410-MONOMER.
ARA:GQT-1411-MONOMER.
ARA:GQT-2575-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
CBL-interacting serine/threonine-protein kinase 3 (EC:2.7.11.1)
Alternative name(s):
SNF1-related kinase 3.17
SOS2-like protein kinase PKS12
Gene namesi
Name:CIPK3
Synonyms:PKS12, SnRK3.17
Ordered Locus Names:At2g26980
ORF Names:T20P8.3
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G26980.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 441441CBL-interacting serine/threonine-protein kinase 3PRO_0000337206Add
BLAST

Proteomic databases

PaxDbiQ2V452.
PRIDEiQ2V452.

PTM databases

iPTMnetiQ2V452.

Expressioni

Tissue specificityi

Mostly expressed in germinating seeds and young seedlings. Detected at low levels in roots, stems, leaves and flowers.1 Publication

Inductioni

By stresses such as cold, drought, high salt, wounding, and abscisic acid (ABA).1 Publication

Gene expression databases

ExpressionAtlasiQ2V452. baseline and differential.
GenevisibleiQ2V452. AT.

Interactioni

Subunit structurei

Interacts with CBL3 and CBL9.2 Publications

Protein-protein interaction databases

BioGridi2592. 8 interactions.
IntActiQ2V452. 2 interactions.
STRINGi3702.AT2G26980.4.

Structurei

3D structure databases

ProteinModelPortaliQ2V452.
SMRiQ2V452. Positions 11-430.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini14 – 269256Protein kinasePROSITE-ProRule annotationAdd
BLAST
Domaini307 – 33125NAFPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni155 – 18430Activation loopBy similarityAdd
BLAST
Regioni337 – 36630PPIBy similarityAdd
BLAST

Domaini

The activation loop within the kinase domain is the target of phosphorylation/activation by upstream protein kinases. The PPI motif mediates the interaction with the ABI (abscisic acid-insensitive) phosphatases (By similarity).By similarity

Sequence similaritiesi

Contains 1 NAF domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0583. Eukaryota.
COG0515. LUCA.
InParanoidiQ2V452.
PhylomeDBiQ2V452.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR018451. NAF/FISL_domain.
IPR004041. NAF_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF03822. NAF. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50816. NAF. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q2V452-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRRQQVKRR VGKYEVGRTI GEGTFAKVKF ARNSETGEPV ALKILDKEKV
60 70 80 90 100
LKHKMAEQIR REIATMKLIK HPNVVQLYEV MASKTKIFII LEYVTGGELF
110 120 130 140 150
DKIVNDGRMK EDEARRYFQQ LIHAVDYCHS RGVYHRDLKP ENLLLDSYGN
160 170 180 190 200
LKISDFGLSA LSQQVRDDGL LHTSCGTPNY VAPEVLNDRG YDGATADMWS
210 220 230 240 250
CGVVLYVLLA GYLPFDDSNL MNLYKKISSG EFNCPPWLSL GAMKLITRIL
260 270 280 290 300
DPNPMTRVTP QEVFEDEWFK KDYKPPVFEE RDDSNMDDID AVFKDSEEHL
310 320 330 340 350
VTEKREEQPA AINAFEIISM SRGLNLENLF DPEQEFKRET RITLRGGANE
360 370 380 390 400
IIEKIEEAAK PLGFDVQKKN YKMRLENVKA GRKGNLNVAT EIFQVAPSLH
410 420 430 440
MVQVSKSKGD TLEFHKFYKK LSNSLEQVVW TNNEVKKETA K
Length:441
Mass (Da):50,600
Last modified:September 22, 2009 - v2
Checksum:i1B9D9CB78E178138
GO
Isoform 1 (identifier: Q2V452-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIPNKKLRE

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:450
Mass (Da):51,692
Checksum:iC4C4B8C8C855728F
GO
Isoform 3 (identifier: Q2V452-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     373-382: MRLENVKAGR → VSENSVTEMK
     383-441: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:382
Mass (Da):43,847
Checksum:iDE465E7A6B6CAF12
GO
Isoform 4 (identifier: Q2V452-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-441: IFQVAPSLHM...NNEVKKETAK → VCYMRLDIQESVGDGLLNQCVFCLYGVTTSRYS

Note: Derived from EST data. May be due to an intron retention. No experimental confirmation available.
Show »
Length:424
Mass (Da):48,541
Checksum:iA6A24548C4A55E36
GO
Isoform 5 (identifier: Q2V452-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     373-375: MRL → YIT
     376-441: Missing.

Note: May be due to a competing acceptor splice site. No experimental confirmation available.
Show »
Length:375
Mass (Da):43,119
Checksum:i086A43AE6146139E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLIPNKKLRE in isoform 1. 1 PublicationVSP_038051
Alternative sequencei373 – 38210MRLENVKAGR → VSENSVTEMK in isoform 3. 1 PublicationVSP_033979
Alternative sequencei373 – 3753MRL → YIT in isoform 5. 1 PublicationVSP_033980
Alternative sequencei376 – 44166Missing in isoform 5. 1 PublicationVSP_038049Add
BLAST
Alternative sequencei383 – 44159Missing in isoform 3. 1 PublicationVSP_038050Add
BLAST
Alternative sequencei392 – 44150IFQVA…KETAK → VCYMRLDIQESVGDGLLNQC VFCLYGVTTSRYS in isoform 4. CuratedVSP_033981Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286051 mRNA. Translation: AAF86507.1.
AY266298 mRNA. Translation: AAP22036.1.
AC005623 Genomic DNA. Translation: AAC77856.2.
AC005623 Genomic DNA. Translation: AAM15068.1.
CP002685 Genomic DNA. Translation: AEC07915.1.
CP002685 Genomic DNA. Translation: AEC07916.1.
CP002685 Genomic DNA. Translation: AEC07918.1.
AF367290 mRNA. Translation: AAK56278.1.
AY059163 mRNA. Translation: AAL15388.1.
AY091098 mRNA. Translation: AAM14049.1.
AY142671 mRNA. Translation: AAN13209.1.
AK229978 mRNA. Translation: BAF01803.1.
PIRiC84667.
RefSeqiNP_850092.1. NM_179761.2. [Q2V452-3]
NP_850093.1. NM_179762.2. [Q2V452-5]
NP_850094.1. NM_179763.3. [Q2V452-2]
UniGeneiAt.13161.

Genome annotation databases

EnsemblPlantsiAT2G26980.3; AT2G26980.3; AT2G26980. [Q2V452-2]
GeneIDi817240.
KEGGiath:AT2G26980.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286051 mRNA. Translation: AAF86507.1.
AY266298 mRNA. Translation: AAP22036.1.
AC005623 Genomic DNA. Translation: AAC77856.2.
AC005623 Genomic DNA. Translation: AAM15068.1.
CP002685 Genomic DNA. Translation: AEC07915.1.
CP002685 Genomic DNA. Translation: AEC07916.1.
CP002685 Genomic DNA. Translation: AEC07918.1.
AF367290 mRNA. Translation: AAK56278.1.
AY059163 mRNA. Translation: AAL15388.1.
AY091098 mRNA. Translation: AAM14049.1.
AY142671 mRNA. Translation: AAN13209.1.
AK229978 mRNA. Translation: BAF01803.1.
PIRiC84667.
RefSeqiNP_850092.1. NM_179761.2. [Q2V452-3]
NP_850093.1. NM_179762.2. [Q2V452-5]
NP_850094.1. NM_179763.3. [Q2V452-2]
UniGeneiAt.13161.

3D structure databases

ProteinModelPortaliQ2V452.
SMRiQ2V452. Positions 11-430.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi2592. 8 interactions.
IntActiQ2V452. 2 interactions.
STRINGi3702.AT2G26980.4.

PTM databases

iPTMnetiQ2V452.

Proteomic databases

PaxDbiQ2V452.
PRIDEiQ2V452.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G26980.3; AT2G26980.3; AT2G26980. [Q2V452-2]
GeneIDi817240.
KEGGiath:AT2G26980.

Organism-specific databases

TAIRiAT2G26980.

Phylogenomic databases

eggNOGiKOG0583. Eukaryota.
COG0515. LUCA.
InParanoidiQ2V452.
PhylomeDBiQ2V452.

Enzyme and pathway databases

BioCyciARA:AT2G26980-MONOMER.
ARA:GQT-1408-MONOMER.
ARA:GQT-1410-MONOMER.
ARA:GQT-1411-MONOMER.
ARA:GQT-2575-MONOMER.

Miscellaneous databases

PROiQ2V452.

Gene expression databases

ExpressionAtlasiQ2V452. baseline and differential.
GenevisibleiQ2V452. AT.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR018451. NAF/FISL_domain.
IPR004041. NAF_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF03822. NAF. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50816. NAF. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCIPK3_ARATH
AccessioniPrimary (citable) accession number: Q2V452
Secondary accession number(s): Q0WM53
, Q2V451, Q8RWU8, Q93VA4, Q9LKC9, Q9ZVD9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: September 22, 2009
Last modified: July 6, 2016
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.