Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prickle-like protein 4

Gene

PRICKLE4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Prickle-like protein 4
Alternative name(s):
Overexpressed breast tumor protein
Gene namesi
Name:PRICKLE4
Synonyms:C6orf49, OEBT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000124593.14
HGNCiHGNC:16805 PRICKLE4
MIMi611389 gene
neXtProtiNX_Q2TBC4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000124593
PharmGKBiPA162400083

Polymorphism and mutation databases

BioMutaiPRICKLE4

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002316191 – 344Prickle-like protein 4Add BLAST344

Proteomic databases

PaxDbiQ2TBC4
PRIDEiQ2TBC4

PTM databases

iPTMnetiQ2TBC4
PhosphoSitePlusiQ2TBC4

Expressioni

Tissue specificityi

Expressed in a broad range of normal tissues as well as in hepatocellular carcinoma, breast cancer and prostate cancer tissues.1 Publication

Gene expression databases

BgeeiENSG00000124593
CleanExiHS_PRICKLE4
ExpressionAtlasiQ2TBC4 baseline and differential
GenevisibleiQ2TBC4 HS

Organism-specific databases

HPAiHPA031240

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000335185

Structurei

3D structure databases

ProteinModelPortaliQ2TBC4
SMRiQ2TBC4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 81PETPROSITE-ProRule annotationAdd BLAST81
Domaini82 – 147LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST66
Domaini148 – 207LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi303 – 308Poly-Ser6

Sequence similaritiesi

Belongs to the prickle / espinas / testin family.Curated

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1704 Eukaryota
ENOG410XP0W LUCA
GeneTreeiENSGT00550000074438
HOGENOMiHOG000293417
HOVERGENiHBG101612
InParanoidiQ2TBC4
KOiK04511
OMAiNASKKHC
OrthoDBiEOG091G07C5
PhylomeDBiQ2TBC4
TreeFamiTF313265

Family and domain databases

InterProiView protein in InterPro
IPR010442 PET_domain
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
PF06297 PET, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 2 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits
PS51303 PET, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2TBC4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPQGPAVLS LGSLCLDTNQ APNWTGLQTL LQQLPPQDID ERYCLALGEE
60 70 80 90 100
ERAELQLFCA RRKQEALGQG VARLVLPKLE GHTCEKCREL LKPGEYGVFA
110 120 130 140 150
ARAGEQRCWH QPCFACQACG QALINLIYFY HDGQLYCGRH HAELLRPRCP
160 170 180 190 200
ACDQLIFSWR CTEAEGQRWH ENHFCCQDCA GPLGGGRYAL PGGSPCCPSC
210 220 230 240 250
FENRYSDAGS SWAGALEGQA FLGETGLDRT EGRDQTSVNS ATLSRTLLAA
260 270 280 290 300
AGGSSLQTQR GLPGSSPQQE NRPGDKAEAP KGQEQCRLET IRDPKDTPFS
310 320 330 340
TCSSSSDSEP EGFFLGERLP QSWKTPGSLQ AEDSNASKTH CTMC
Length:344
Mass (Da):37,551
Last modified:April 4, 2006 - v2
Checksum:iBB23045A87A4135F
GO
Isoform 2 (identifier: Q2TBC4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-344: ETGLDRTEGR...NASKTHCTMC → APPPHPPDPS...GWASPPLAAV

Show »
Length:312
Mass (Da):33,333
Checksum:iCC0282871BE96BED
GO
Isoform 3 (identifier: Q2TBC4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSP → MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHA

Show »
Length:384
Mass (Da):41,766
Checksum:iA718A81314E026E1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti248L → LL in AAI10460 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056165266S → R. Corresponds to variant dbSNP:rs28403585Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0393771 – 3MSP → MSVQNSGWPHQEDSPKPQDP GPPANSDSDSGHLPGEDPED THA in isoform 3. 1 Publication3
Alternative sequenceiVSP_017857224 – 344ETGLD…HCTMC → APPPHPPDPSLGARSSHRAS LAGAFQGPPEPTPRRGRGCG ARLPPRRGRRTPSGGGGGPW RGLSAAAAARTAQGLGGAGG WASPPLAAV in isoform 2. 1 PublicationAdd BLAST121

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL137721 mRNA Translation: CAB70893.1
AK057184 mRNA Translation: BAG51877.1
AL365205 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04063.1
BC110459 mRNA Translation: AAI10460.1
CCDSiCCDS34449.1 [Q2TBC4-3]
PIRiT46255
RefSeqiNP_037529.3, NM_013397.5 [Q2TBC4-3]
UniGeneiHs.715653

Genome annotation databases

EnsembliENST00000394259; ENSP00000377802; ENSG00000278224 [Q2TBC4-2]
ENST00000394260; ENSP00000377803; ENSG00000278224 [Q2TBC4-1]
ENST00000394263; ENSP00000377806; ENSG00000278224 [Q2TBC4-3]
ENST00000458694; ENSP00000404911; ENSG00000278224 [Q2TBC4-3]
GeneIDi29964
KEGGihsa:29964
UCSCiuc011duf.2 human [Q2TBC4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPRIC4_HUMAN
AccessioniPrimary (citable) accession number: Q2TBC4
Secondary accession number(s): A2A3M0
, A6PVU1, B3KQ15, Q5T3D4, Q9NSV1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: April 4, 2006
Last modified: April 25, 2018
This is version 114 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome