Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prickle-like protein 4

Gene

PRICKLE4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Prickle-like protein 4
Alternative name(s):
Overexpressed breast tumor protein
Gene namesi
Name:PRICKLE4
Synonyms:C6orf49, OEBT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:16805. PRICKLE4.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400083.

Polymorphism and mutation databases

BioMutaiPRICKLE4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344Prickle-like protein 4PRO_0000231619Add
BLAST

Proteomic databases

PaxDbiQ2TBC4.
PeptideAtlasiQ2TBC4.
PRIDEiQ2TBC4.

PTM databases

iPTMnetiQ2TBC4.
PhosphoSiteiQ2TBC4.

Expressioni

Tissue specificityi

Expressed in a broad range of normal tissues as well as in hepatocellular carcinoma, breast cancer and prostate cancer tissues.1 Publication

Gene expression databases

BgeeiQ2TBC4.
CleanExiHS_PRICKLE4.
ExpressionAtlasiQ2TBC4. baseline and differential.
GenevisibleiQ2TBC4. HS.

Organism-specific databases

HPAiHPA031240.
HPA055593.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000335185.

Structurei

3D structure databases

ProteinModelPortaliQ2TBC4.
SMRiQ2TBC4. Positions 146-201.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 8181PETPROSITE-ProRule annotationAdd
BLAST
Domaini82 – 14766LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini148 – 20760LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi303 – 3086Poly-Ser

Sequence similaritiesi

Belongs to the prickle / espinas / testin family.Curated
Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PET domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1704. Eukaryota.
ENOG410XP0W. LUCA.
GeneTreeiENSGT00550000074438.
HOGENOMiHOG000293417.
HOVERGENiHBG101612.
InParanoidiQ2TBC4.
OMAiHARASCL.
PhylomeDBiQ2TBC4.
TreeFamiTF313265.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR010442. PET_domain.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF06297. PET. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS51303. PET. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2TBC4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPQGPAVLS LGSLCLDTNQ APNWTGLQTL LQQLPPQDID ERYCLALGEE
60 70 80 90 100
ERAELQLFCA RRKQEALGQG VARLVLPKLE GHTCEKCREL LKPGEYGVFA
110 120 130 140 150
ARAGEQRCWH QPCFACQACG QALINLIYFY HDGQLYCGRH HAELLRPRCP
160 170 180 190 200
ACDQLIFSWR CTEAEGQRWH ENHFCCQDCA GPLGGGRYAL PGGSPCCPSC
210 220 230 240 250
FENRYSDAGS SWAGALEGQA FLGETGLDRT EGRDQTSVNS ATLSRTLLAA
260 270 280 290 300
AGGSSLQTQR GLPGSSPQQE NRPGDKAEAP KGQEQCRLET IRDPKDTPFS
310 320 330 340
TCSSSSDSEP EGFFLGERLP QSWKTPGSLQ AEDSNASKTH CTMC
Length:344
Mass (Da):37,551
Last modified:April 4, 2006 - v2
Checksum:iBB23045A87A4135F
GO
Isoform 2 (identifier: Q2TBC4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-344: ETGLDRTEGR...NASKTHCTMC → APPPHPPDPS...GWASPPLAAV

Show »
Length:312
Mass (Da):33,333
Checksum:iCC0282871BE96BED
GO
Isoform 3 (identifier: Q2TBC4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MSP → MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHA

Show »
Length:384
Mass (Da):41,766
Checksum:iA718A81314E026E1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti248 – 2481L → LL in AAI10460 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti266 – 2661S → R.
Corresponds to variant rs28403585 [ dbSNP | Ensembl ].
VAR_056165

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 33MSP → MSVQNSGWPHQEDSPKPQDP GPPANSDSDSGHLPGEDPED THA in isoform 3. 1 PublicationVSP_039377
Alternative sequencei224 – 344121ETGLD…HCTMC → APPPHPPDPSLGARSSHRAS LAGAFQGPPEPTPRRGRGCG ARLPPRRGRRTPSGGGGGPW RGLSAAAAARTAQGLGGAGG WASPPLAAV in isoform 2. 1 PublicationVSP_017857Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL137721 mRNA. Translation: CAB70893.1.
AK057184 mRNA. Translation: BAG51877.1.
AL365205 Genomic DNA. Translation: CAI13185.1.
AL365205 Genomic DNA. Translation: CAM16153.1.
AL365205 Genomic DNA. Translation: CAO72057.1.
CH471081 Genomic DNA. Translation: EAX04063.1.
BC110459 mRNA. Translation: AAI10460.1.
CCDSiCCDS34449.1. [Q2TBC4-3]
PIRiT46255.
RefSeqiNP_037529.3. NM_013397.5. [Q2TBC4-3]
UniGeneiHs.715653.

Genome annotation databases

EnsembliENST00000335515; ENSP00000335185; ENSG00000124593. [Q2TBC4-3]
ENST00000359201; ENSP00000352128; ENSG00000124593. [Q2TBC4-1]
ENST00000394259; ENSP00000377802; ENSG00000278224. [Q2TBC4-2]
ENST00000394260; ENSP00000377803; ENSG00000278224. [Q2TBC4-1]
ENST00000394263; ENSP00000377806; ENSG00000278224. [Q2TBC4-3]
ENST00000458694; ENSP00000404911; ENSG00000124593. [Q2TBC4-3]
GeneIDi29964.
KEGGihsa:29964.
UCSCiuc011duf.2. human. [Q2TBC4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL137721 mRNA. Translation: CAB70893.1.
AK057184 mRNA. Translation: BAG51877.1.
AL365205 Genomic DNA. Translation: CAI13185.1.
AL365205 Genomic DNA. Translation: CAM16153.1.
AL365205 Genomic DNA. Translation: CAO72057.1.
CH471081 Genomic DNA. Translation: EAX04063.1.
BC110459 mRNA. Translation: AAI10460.1.
CCDSiCCDS34449.1. [Q2TBC4-3]
PIRiT46255.
RefSeqiNP_037529.3. NM_013397.5. [Q2TBC4-3]
UniGeneiHs.715653.

3D structure databases

ProteinModelPortaliQ2TBC4.
SMRiQ2TBC4. Positions 146-201.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000335185.

PTM databases

iPTMnetiQ2TBC4.
PhosphoSiteiQ2TBC4.

Polymorphism and mutation databases

BioMutaiPRICKLE4.

Proteomic databases

PaxDbiQ2TBC4.
PeptideAtlasiQ2TBC4.
PRIDEiQ2TBC4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335515; ENSP00000335185; ENSG00000124593. [Q2TBC4-3]
ENST00000359201; ENSP00000352128; ENSG00000124593. [Q2TBC4-1]
ENST00000394259; ENSP00000377802; ENSG00000278224. [Q2TBC4-2]
ENST00000394260; ENSP00000377803; ENSG00000278224. [Q2TBC4-1]
ENST00000394263; ENSP00000377806; ENSG00000278224. [Q2TBC4-3]
ENST00000458694; ENSP00000404911; ENSG00000124593. [Q2TBC4-3]
GeneIDi29964.
KEGGihsa:29964.
UCSCiuc011duf.2. human. [Q2TBC4-1]

Organism-specific databases

CTDi29964.
GeneCardsiPRICKLE4.
HGNCiHGNC:16805. PRICKLE4.
HPAiHPA031240.
HPA055593.
MIMi611389. gene.
neXtProtiNX_Q2TBC4.
PharmGKBiPA162400083.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1704. Eukaryota.
ENOG410XP0W. LUCA.
GeneTreeiENSGT00550000074438.
HOGENOMiHOG000293417.
HOVERGENiHBG101612.
InParanoidiQ2TBC4.
OMAiHARASCL.
PhylomeDBiQ2TBC4.
TreeFamiTF313265.

Miscellaneous databases

ChiTaRSiPRICKLE4. human.
GeneWikiiC6orf49.
GenomeRNAii29964.
PROiQ2TBC4.
SOURCEiSearch...

Gene expression databases

BgeeiQ2TBC4.
CleanExiHS_PRICKLE4.
ExpressionAtlasiQ2TBC4. baseline and differential.
GenevisibleiQ2TBC4. HS.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR010442. PET_domain.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF06297. PET. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS51303. PET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Stomach.
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Characterization of OEBT, a LIM protein."
    Teufel A., Weinmann A., Galle P.R., Lohse A.W.
    Int. J. Mol. Med. 15:513-518(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiPRIC4_HUMAN
AccessioniPrimary (citable) accession number: Q2TBC4
Secondary accession number(s): A2A3M0
, A6PVU1, B3KQ15, Q5T3D4, Q9NSV1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: April 4, 2006
Last modified: July 6, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.