Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative hexokinase HKDC1

Gene

HKDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + D-hexose = ADP + D-hexose 6-phosphate.

Pathwayi: hexose metabolism

This protein is involved in the pathway hexose metabolism, which is part of Carbohydrate metabolism.
View all proteins of this organism that are known to be involved in the pathway hexose metabolism and in Carbohydrate metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei557ATPSequence analysis1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi84 – 89ATPSequence analysis6
Nucleotide bindingi532 – 537ATPSequence analysis6

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Glycolysis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS08135-MONOMER.
UniPathwayiUPA00242.

Names & Taxonomyi

Protein namesi
Recommended name:
Putative hexokinase HKDC1 (EC:2.7.1.1)
Alternative name(s):
Hexokinase domain-containing protein 1
Gene namesi
Name:HKDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23302. HKDC1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi80201.
OpenTargetsiENSG00000156510.
PharmGKBiPA134866195.

Chemistry databases

ChEMBLiCHEMBL1741200.

Polymorphism and mutation databases

BioMutaiHKDC1.
DMDMi311033440.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002990351 – 917Putative hexokinase HKDC1Add BLAST917

Proteomic databases

EPDiQ2TB90.
MaxQBiQ2TB90.
PaxDbiQ2TB90.
PeptideAtlasiQ2TB90.
PRIDEiQ2TB90.

PTM databases

iPTMnetiQ2TB90.
PhosphoSitePlusiQ2TB90.

Expressioni

Gene expression databases

BgeeiENSG00000156510.
CleanExiHS_HKDC1.
GenevisibleiQ2TB90. HS.

Organism-specific databases

HPAiHPA011956.
HPA064198.
HPA064230.

Interactioni

Protein-protein interaction databases

BioGridi123172. 4 interactors.
STRINGi9606.ENSP00000346643.

Structurei

3D structure databases

ProteinModelPortaliQ2TB90.
SMRiQ2TB90.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini16 – 458Hexokinase 1PROSITE-ProRule annotationAdd BLAST443
Domaini464 – 905Hexokinase 2PROSITE-ProRule annotationAdd BLAST442

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni73 – 207Hexokinase small subdomain 1PROSITE-ProRule annotationAdd BLAST135
Regioni149 – 175Glucose-bindingSequence analysisAdd BLAST27
Regioni208 – 447Hexokinase large subdomain 1PROSITE-ProRule annotationAdd BLAST240
Regioni521 – 654Hexokinase small subdomain 2PROSITE-ProRule annotationAdd BLAST134
Regioni596 – 622Glucose-bindingSequence analysisAdd BLAST27
Regioni655 – 894Hexokinase large subdomain 2PROSITE-ProRule annotationAdd BLAST240

Sequence similaritiesi

Belongs to the hexokinase family.PROSITE-ProRule annotationCurated
Contains 2 hexokinase domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1369. Eukaryota.
COG5026. LUCA.
GeneTreeiENSGT00390000017159.
HOVERGENiHBG005020.
InParanoidiQ2TB90.
KOiK00844.
OMAiKIETRHV.
OrthoDBiEOG091G08MD.
PhylomeDBiQ2TB90.
TreeFamiTF314238.

Family and domain databases

InterProiIPR001312. Hexokinase.
IPR019807. Hexokinase_BS.
IPR022673. Hexokinase_C.
IPR022672. Hexokinase_N.
[Graphical view]
PANTHERiPTHR19443. PTHR19443. 1 hit.
PfamiPF00349. Hexokinase_1. 2 hits.
PF03727. Hexokinase_2. 2 hits.
[Graphical view]
PROSITEiPS00378. HEXOKINASE_1. 1 hit.
PS51748. HEXOKINASE_2. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2TB90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFAVHLMAFY FSKLKEDQIK KVDRFLYHMR LSDDTLLDIM RRFRAEMEKG
60 70 80 90 100
LAKDTNPTAA VKMLPTFVRA IPDGSENGEF LSLDLGGSKF RVLKVQVAEE
110 120 130 140 150
GKRHVQMESQ FYPTPNEIIR GNGTELFEYV ADCLADFMKT KDLKHKKLPL
160 170 180 190 200
GLTFSFPCRQ TKLEEGVLLS WTKKFKARGV QDTDVVSRLT KAMRRHKDMD
210 220 230 240 250
VDILALVNDT VGTMMTCAYD DPYCEVGVII GTGTNACYME DMSNIDLVEG
260 270 280 290 300
DEGRMCINTE WGAFGDDGAL EDIRTEFDRE LDLGSLNPGK QLFEKMISGL
310 320 330 340 350
YLGELVRLIL LKMAKAGLLF GGEKSSALHT KGKIETRHVA AMEKYKEGLA
360 370 380 390 400
NTREILVDLG LEPSEADCIA VQHVCTIVSF RSANLCAAAL AAILTRLREN
410 420 430 440 450
KKVERLRTTV GMDGTLYKIH PQYPKRLHKV VRKLVPSCDV RFLLSESGST
460 470 480 490 500
KGAAMVTAVA SRVQAQRKQI DRVLALFQLT REQLVDVQAK MRAELEYGLK
510 520 530 540 550
KKSHGLATVR MLPTYVCGLP DGTEKGKFLA LDLGGTNFRV LLVKIRSGRR
560 570 580 590 600
SVRMYNKIFA IPLEIMQGTG EELFDHIVQC IADFLDYMGL KGASLPLGFT
610 620 630 640 650
FSFPCRQMSI DKGTLIGWTK GFKATDCEGE DVVDMLREAI KRRNEFDLDI
660 670 680 690 700
VAVVNDTVGT MMTCGYEDPN CEIGLIAGTG SNMCYMEDMR NIEMVEGGEG
710 720 730 740 750
KMCINTEWGG FGDNGCIDDI WTRYDTEVDE GSLNPGKQRY EKMTSGMYLG
760 770 780 790 800
EIVRQILIDL TKQGLLFRGQ ISERLRTRGI FETKFLSQIE SDRLALLQVR
810 820 830 840 850
RILQQLGLDS TCEDSIVVKE VCGAVSRRAA QLCGAGLAAI VEKRREDQGL
860 870 880 890 900
EHLRITVGVD GTLYKLHPHF SRILQETVKE LAPRCDVTFM LSEDGSGKGA
910
ALITAVAKRL QQAQKEN
Length:917
Mass (Da):102,545
Last modified:November 2, 2010 - v3
Checksum:iF7E32F3F2B4118B6
GO
Isoform 2 (identifier: Q2TB90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     791-806: SDRLALLQVRRILQQL → RMLSVIDAYCLDLLFH
     807-917: Missing.

Note: No experimental confirmation available.
Show »
Length:806
Mass (Da):90,575
Checksum:iF80F5F2C2DE8AAEA
GO
Isoform 3 (identifier: Q2TB90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     705-736: NTEWGGFGDNGCIDDIWTRYDTEVDEGSLNPG → CFSFCLWFVLQVLIVVLRIVRYRKSSKLIKKF
     737-917: Missing.

Note: No experimental confirmation available.
Show »
Length:736
Mass (Da):82,682
Checksum:i20C1B85111209665
GO

Sequence cautioni

The sequence AAH21278 differs from that shown. Reason: Frameshift at position 457.Curated
The sequence BAB15478 differs from that shown. Reason: Frameshift at position 345.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03477654D → G.Corresponds to variant rs10823320dbSNPEnsembl.1
Natural variantiVAR_034777124T → I.Corresponds to variant rs874556dbSNPEnsembl.1
Natural variantiVAR_034778204L → P.Corresponds to variant rs7899445dbSNPEnsembl.1
Natural variantiVAR_034779721W → R.2 PublicationsCorresponds to variant rs1111335dbSNPEnsembl.1
Natural variantiVAR_034780917N → K.Corresponds to variant rs906219dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027533705 – 736NTEWG…SLNPG → CFSFCLWFVLQVLIVVLRIV RYRKSSKLIKKF in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027534737 – 917Missing in isoform 3. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_027535791 – 806SDRLA…ILQQL → RMLSVIDAYCLDLLFH in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_027536807 – 917Missing in isoform 2. 1 PublicationAdd BLAST111

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL596223 Genomic DNA. Translation: CAH71500.1.
BC012337 mRNA. Translation: AAH12337.1.
BC021278 mRNA. Translation: AAH21278.1. Frameshift.
BC110504 mRNA. Translation: AAI10505.1.
BC110505 mRNA. Translation: AAI10506.2.
AK026414 mRNA. Translation: BAB15478.1. Frameshift.
BX538078 mRNA. Translation: CAD98002.1.
CCDSiCCDS7288.1. [Q2TB90-1]
RefSeqiNP_079406.3. NM_025130.3.
UniGeneiHs.522988.

Genome annotation databases

EnsembliENST00000354624; ENSP00000346643; ENSG00000156510. [Q2TB90-1]
GeneIDi80201.
KEGGihsa:80201.
UCSCiuc001jpf.4. human. [Q2TB90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL596223 Genomic DNA. Translation: CAH71500.1.
BC012337 mRNA. Translation: AAH12337.1.
BC021278 mRNA. Translation: AAH21278.1. Frameshift.
BC110504 mRNA. Translation: AAI10505.1.
BC110505 mRNA. Translation: AAI10506.2.
AK026414 mRNA. Translation: BAB15478.1. Frameshift.
BX538078 mRNA. Translation: CAD98002.1.
CCDSiCCDS7288.1. [Q2TB90-1]
RefSeqiNP_079406.3. NM_025130.3.
UniGeneiHs.522988.

3D structure databases

ProteinModelPortaliQ2TB90.
SMRiQ2TB90.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123172. 4 interactors.
STRINGi9606.ENSP00000346643.

Chemistry databases

ChEMBLiCHEMBL1741200.

PTM databases

iPTMnetiQ2TB90.
PhosphoSitePlusiQ2TB90.

Polymorphism and mutation databases

BioMutaiHKDC1.
DMDMi311033440.

Proteomic databases

EPDiQ2TB90.
MaxQBiQ2TB90.
PaxDbiQ2TB90.
PeptideAtlasiQ2TB90.
PRIDEiQ2TB90.

Protocols and materials databases

DNASUi80201.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354624; ENSP00000346643; ENSG00000156510. [Q2TB90-1]
GeneIDi80201.
KEGGihsa:80201.
UCSCiuc001jpf.4. human. [Q2TB90-1]

Organism-specific databases

CTDi80201.
DisGeNETi80201.
GeneCardsiHKDC1.
HGNCiHGNC:23302. HKDC1.
HPAiHPA011956.
HPA064198.
HPA064230.
neXtProtiNX_Q2TB90.
OpenTargetsiENSG00000156510.
PharmGKBiPA134866195.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1369. Eukaryota.
COG5026. LUCA.
GeneTreeiENSGT00390000017159.
HOVERGENiHBG005020.
InParanoidiQ2TB90.
KOiK00844.
OMAiKIETRHV.
OrthoDBiEOG091G08MD.
PhylomeDBiQ2TB90.
TreeFamiTF314238.

Enzyme and pathway databases

UniPathwayiUPA00242.
BioCyciZFISH:HS08135-MONOMER.

Miscellaneous databases

GenomeRNAii80201.
PROiQ2TB90.

Gene expression databases

BgeeiENSG00000156510.
CleanExiHS_HKDC1.
GenevisibleiQ2TB90. HS.

Family and domain databases

InterProiIPR001312. Hexokinase.
IPR019807. Hexokinase_BS.
IPR022673. Hexokinase_C.
IPR022672. Hexokinase_N.
[Graphical view]
PANTHERiPTHR19443. PTHR19443. 1 hit.
PfamiPF00349. Hexokinase_1. 2 hits.
PF03727. Hexokinase_2. 2 hits.
[Graphical view]
PROSITEiPS00378. HEXOKINASE_1. 1 hit.
PS51748. HEXOKINASE_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHKDC1_HUMAN
AccessioniPrimary (citable) accession number: Q2TB90
Secondary accession number(s): B5MDN9
, Q2TB91, Q5VTC7, Q7Z373, Q8WU37, Q96EH2, Q9H5Y9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: November 2, 2010
Last modified: November 2, 2016
This is version 93 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.