Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral GTPase-activating protein subunit alpha-2

Gene

RALGAPA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic subunit of the heterodimeric RalGAP2 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-1445148. Translocation of GLUT4 to the plasma membrane.

Names & Taxonomyi

Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-2
Alternative name(s):
250 kDa substrate of Akt
Short name:
AS250
p220
Gene namesi
Name:RALGAPA2
Synonyms:C20orf74, KIAA1272
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:16207. RALGAPA2.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular space Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25784.

Polymorphism and mutation databases

BioMutaiRALGAPA2.
DMDMi147742932.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18731873Ral GTPase-activating protein subunit alpha-2PRO_0000286972Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei373 – 3731PhosphoserineBy similarity
Modified residuei376 – 3761PhosphoserineBy similarity
Modified residuei379 – 3791PhosphoserineBy similarity
Modified residuei486 – 4861Phosphoserine; by PKBCombined sources1 Publication
Modified residuei696 – 6961Phosphoserine; by PKB1 Publication
Modified residuei715 – 7151Phosphothreonine; by PKB1 Publication
Modified residuei820 – 8201PhosphoserineCombined sources
Modified residuei821 – 8211PhosphoserineCombined sources
Modified residuei1593 – 15931PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ2PPJ7.
MaxQBiQ2PPJ7.
PaxDbiQ2PPJ7.
PRIDEiQ2PPJ7.

PTM databases

iPTMnetiQ2PPJ7.
PhosphoSiteiQ2PPJ7.
SwissPalmiQ2PPJ7.

Expressioni

Gene expression databases

BgeeiQ2PPJ7.
CleanExiHS_C20orf74.
ExpressionAtlasiQ2PPJ7. baseline and differential.
GenevisibleiQ2PPJ7. HS.

Organism-specific databases

HPAiHPA042707.
HPA043622.

Interactioni

Subunit structurei

Component of the heterodimeric RalGAP2 complex with RALGAPB. Heterodimerization is required for activity (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121435. 5 interactions.
IntActiQ2PPJ7. 1 interaction.
STRINGi9606.ENSP00000202677.

Structurei

3D structure databases

ProteinModelPortaliQ2PPJ7.
SMRiQ2PPJ7. Positions 1630-1844.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1635 – 1843209Rap-GAPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi757 – 7604Poly-Gln
Compositional biasi790 – 7934Poly-Ser

Sequence similaritiesi

Contains 1 Rap-GAP domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3686. Eukaryota.
ENOG410XTIX. LUCA.
GeneTreeiENSGT00760000119182.
HOVERGENiHBG051842.
InParanoidiQ2PPJ7.
OMAiASRAVKC.
PhylomeDBiQ2PPJ7.
TreeFamiTF324484.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02145. Rap_GAP. 1 hit.
[Graphical view]
SUPFAMiSSF111347. SSF111347. 1 hit.
SSF48371. SSF48371. 1 hit.
PROSITEiPS50085. RAPGAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2PPJ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSRRSHGDV KKSTQKVLDP KKDVLTRLKH LRALLDNVDA NDLKQFFETN
60 70 80 90 100
YSQIYFIFYE NFIALENSLK LKGNNKSQRE ELDSILFLFE KILQFLPERI
110 120 130 140 150
FFRWHYQSIG STLKKLLHTG NSIKIRCEGI RLFLLWLQAL QTNCAEEQVL
160 170 180 190 200
IFACLVPGFP AVMSSRGPCT LETLINPSPS VADVKIYPEE ITPLLPAISG
210 220 230 240 250
EKIAEDQTCF FLQILLKYMV IQAASLEWKN KENQDTGFKF LFTLFRKYYL
260 270 280 290 300
PHLFPSFTKL TNIYKPVLDI PHLRPKPVYI TTTRDNENIY STKIPYMAAR
310 320 330 340 350
VVFIKWIVTF FLEKKYLTAT QNTKNGVDVL PKIIQTVGGG AVQERAPELD
360 370 380 390 400
GGGPTEQDKS HSNSSTLSDR RLSNSSLCSI EEEHRMVYEM VQRILLSTRG
410 420 430 440 450
YVNFVNEVFH QAFLLPSCEI AVTRKVVQVY RKWILQDKPV FMEEPDRKDV
460 470 480 490 500
AQEDAEKLGF SETDSKEASS ESSGHKRSSS WGRTYSFTSA MSRGCVTEEE
510 520 530 540 550
NTNVKAGVQA LLQVFLTNSA NIFLLEPCAE VPVLLKEQVD ACKAVLIIFR
560 570 580 590 600
RMIMELTMNK KTWEQMLQIL LRITEAVMQK PKDKQIKDLF AQSLAGLLFR
610 620 630 640 650
TLMVAWIRAN LCVYISRELW DDFLGVLSSL TEWEELINEW ANIMDSLTAV
660 670 680 690 700
LARTVYGVEM TNLPLDKLSE QKEKKQRGKG CVLDPQKGTT VGRSFSLSWR
710 720 730 740 750
SHPDVTEPMR FRSATTSGAP GVEKARNIVR QKATEVEECQ QSENAPAAGS
760 770 780 790 800
GHLTVGQQQQ VLRSSSTSDI PEPLCSDSSQ GQKAENTQNS SSSEPQPIQE
810 820 830 840 850
NKGHVKREHE GITILVRRSS SPAELDLKDD LQQTQGKCRE RQKSESTNSD
860 870 880 890 900
TTLGCTNEAE LSMGPWQTCE EDPELNTPTD VVADADARHW LQLSPTDASN
910 920 930 940 950
LTDSSECLTD DCSIIAGGSL TGWHPDSAAV LWRRVLGILG DVNNIQSPKI
960 970 980 990 1000
HARVFCYLYE LWYKLAKIRD NLAISLDNQS SPSPPVLIPP LRMFASWLFK
1010 1020 1030 1040 1050
AATLPNEYKE GKLQAYRLIC AMMTRRQDVL PNSDFLVHFY LVMHLGLTSE
1060 1070 1080 1090 1100
DQDILNTIIR HCPPRFFSLG FPGFSMLVGD FITAAARVLS TDILTAPRSE
1110 1120 1130 1140 1150
AVTVLGSLVC FPNTYQEIPL LQSVPEVNEA ITGTEDVKHY LINILLKNAT
1160 1170 1180 1190 1200
EEPNEYARCI AVCSLGVWIC EELAQCTSHP QVKEAINVIG VTLKFPNKIV
1210 1220 1230 1240 1250
AQVACDVLQL LVSYWEKLQM FETSLPRKMA EILVATVAFL LPSAEYSSVE
1260 1270 1280 1290 1300
TDKKFIVSLL LCLLDWCMAL PVSVLLHPVS TAVLEEQHSA RAPLLDYIYR
1310 1320 1330 1340 1350
VLHCCVCGSS TYTQQSHYIL TLADLSSTDY DPFLPLANVK SSEPVQYHSS
1360 1370 1380 1390 1400
AELGNLLTVE EEKKRRSLEL IPLTARMVMA HLVNHLGHYP LSGGPAILHS
1410 1420 1430 1440 1450
LVSENHDNAH VEGSELSFEV FRSPNLQLFV FNDSTLISYL QTPTEGPVGG
1460 1470 1480 1490 1500
SPVGSLSDVR VIVRDISGKY SWDGKVLYGP LEGCLAPNGR NPSFLISSWH
1510 1520 1530 1540 1550
RDTFGPQKDS SQVEEGDDVL DKLLENIGHT SPECLLPSQL NLNEPSLTPC
1560 1570 1580 1590 1600
GMNYDQEKEI IEVILRQNAQ EDEYIQSHNF DSAMKVTSQG QPSPVEPRGP
1610 1620 1630 1640 1650
FYFCRLLLDD LGMNSWDRRK NFHLLKKNSK LLRELKNLDS RQCRETHKIA
1660 1670 1680 1690 1700
VFYIAEGQED KCSILSNERG SQAYEDFVAG LGWEVDLSTH CGFMGGLQRN
1710 1720 1730 1740 1750
GSTGQTAPYY ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL GNDEVHIVWS
1760 1770 1780 1790 1800
EHSRDYRRGI IPTAFGDVSI IIYPMKNHMF FIAITKKPEV PFFGPLFDGA
1810 1820 1830 1840 1850
IVSGKLLPSL VCATCINASR AVKCLIPLYQ SFYEERALYL EAIIQNHREV
1860 1870
MTFEDFAAQV FSPSPSYSLS GTD
Length:1,873
Mass (Da):210,770
Last modified:May 15, 2007 - v2
Checksum:iDC33C087B4802541
GO
Isoform 2 (identifier: Q2PPJ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → LYLFALNV

Show »
Length:1,839
Mass (Da):206,862
Checksum:i9A546D26DD09D1B9
GO
Isoform 3 (identifier: Q2PPJ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → PRVR

Show »
Length:1,835
Mass (Da):206,436
Checksum:i10DC3EF9E46D8382
GO

Sequence cautioni

The sequence AAH13749.1 differs from that shown. Reason: Frameshift at positions 1600 and 1843. Curated
The sequence BAB14290.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAI39939.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI40814.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI95626.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1488 – 14881N → S in ABC33805 (PubMed:16490346).Curated
Sequence conflicti1488 – 14881N → S in BAA86586 (PubMed:10574462).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti492 – 4921S → N.
Corresponds to variant rs6137081 [ dbSNP | Ensembl ].
VAR_049157

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1832 – 187342FYEER…LSGTD → LYLFALNV in isoform 2. 1 PublicationVSP_025247Add
BLAST
Alternative sequencei1832 – 187342FYEER…LSGTD → PRVR in isoform 3. 1 PublicationVSP_025248Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ310704 mRNA. Translation: ABC33805.1.
AL157718, AL078634 Genomic DNA. Translation: CAI12810.1.
AL161658, AL078634, AL121896 Genomic DNA. Translation: CAI40814.1. Sequence problems.
AL161658, AL121896 Genomic DNA. Translation: CAI40815.1.
AL078634, AL157718 Genomic DNA. Translation: CAI95625.1.
AL078634, AL121896, AL161658 Genomic DNA. Translation: CAI95626.1. Sequence problems.
AL078634 Genomic DNA. Translation: CAI95627.1.
AL121896, AL078634, AL161658 Genomic DNA. Translation: CAI39939.1. Sequence problems.
AL121896, AL161658 Genomic DNA. Translation: CAI39940.1.
AL121896 Genomic DNA. Translation: CAC27348.1.
AB033098 mRNA. Translation: BAA86586.1.
AK022881 mRNA. Translation: BAB14290.1. Different initiation.
BC013749 mRNA. Translation: AAH13749.1. Frameshift.
CCDSiCCDS46584.1. [Q2PPJ7-1]
RefSeqiNP_065076.2. NM_020343.3. [Q2PPJ7-1]
UniGeneiHs.472285.

Genome annotation databases

EnsembliENST00000202677; ENSP00000202677; ENSG00000188559. [Q2PPJ7-1]
GeneIDi57186.
KEGGihsa:57186.
UCSCiuc002wrz.4. human. [Q2PPJ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ310704 mRNA. Translation: ABC33805.1.
AL157718, AL078634 Genomic DNA. Translation: CAI12810.1.
AL161658, AL078634, AL121896 Genomic DNA. Translation: CAI40814.1. Sequence problems.
AL161658, AL121896 Genomic DNA. Translation: CAI40815.1.
AL078634, AL157718 Genomic DNA. Translation: CAI95625.1.
AL078634, AL121896, AL161658 Genomic DNA. Translation: CAI95626.1. Sequence problems.
AL078634 Genomic DNA. Translation: CAI95627.1.
AL121896, AL078634, AL161658 Genomic DNA. Translation: CAI39939.1. Sequence problems.
AL121896, AL161658 Genomic DNA. Translation: CAI39940.1.
AL121896 Genomic DNA. Translation: CAC27348.1.
AB033098 mRNA. Translation: BAA86586.1.
AK022881 mRNA. Translation: BAB14290.1. Different initiation.
BC013749 mRNA. Translation: AAH13749.1. Frameshift.
CCDSiCCDS46584.1. [Q2PPJ7-1]
RefSeqiNP_065076.2. NM_020343.3. [Q2PPJ7-1]
UniGeneiHs.472285.

3D structure databases

ProteinModelPortaliQ2PPJ7.
SMRiQ2PPJ7. Positions 1630-1844.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121435. 5 interactions.
IntActiQ2PPJ7. 1 interaction.
STRINGi9606.ENSP00000202677.

PTM databases

iPTMnetiQ2PPJ7.
PhosphoSiteiQ2PPJ7.
SwissPalmiQ2PPJ7.

Polymorphism and mutation databases

BioMutaiRALGAPA2.
DMDMi147742932.

Proteomic databases

EPDiQ2PPJ7.
MaxQBiQ2PPJ7.
PaxDbiQ2PPJ7.
PRIDEiQ2PPJ7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000202677; ENSP00000202677; ENSG00000188559. [Q2PPJ7-1]
GeneIDi57186.
KEGGihsa:57186.
UCSCiuc002wrz.4. human. [Q2PPJ7-1]

Organism-specific databases

CTDi57186.
GeneCardsiRALGAPA2.
H-InvDBHIX0015680.
HGNCiHGNC:16207. RALGAPA2.
HPAiHPA042707.
HPA043622.
neXtProtiNX_Q2PPJ7.
PharmGKBiPA25784.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3686. Eukaryota.
ENOG410XTIX. LUCA.
GeneTreeiENSGT00760000119182.
HOVERGENiHBG051842.
InParanoidiQ2PPJ7.
OMAiASRAVKC.
PhylomeDBiQ2PPJ7.
TreeFamiTF324484.

Enzyme and pathway databases

ReactomeiR-HSA-1445148. Translocation of GLUT4 to the plasma membrane.

Miscellaneous databases

ChiTaRSiRALGAPA2. human.
GenomeRNAii57186.
PROiQ2PPJ7.

Gene expression databases

BgeeiQ2PPJ7.
CleanExiHS_C20orf74.
ExpressionAtlasiQ2PPJ7. baseline and differential.
GenevisibleiQ2PPJ7. HS.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02145. Rap_GAP. 1 hit.
[Graphical view]
SUPFAMiSSF111347. SSF111347. 1 hit.
SSF48371. SSF48371. 1 hit.
PROSITEiPS50085. RAPGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Adipocytes contain a novel complex similar to the tuberous sclerosis complex."
    Gridley S., Chavez J.A., Lane W.S., Lienhard G.E.
    Cell. Signal. 18:1626-1632(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH RALGAPB, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-486; SER-696 AND THR-715.
  2. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 813-1873 (ISOFORM 3).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1539-1873 (ISOFORM 2).
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1571-1873 (ISOFORM 1).
    Tissue: Urinary bladder.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-820 AND SER-821, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-820 AND SER-821, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-486; SER-820 AND SER-1593, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiRGPA2_HUMAN
AccessioniPrimary (citable) accession number: Q2PPJ7
Secondary accession number(s): Q4VXU6
, Q5JUA3, Q5JUA4, Q5T9K3, Q96CX9, Q9BQT7, Q9H9D9, Q9ULE8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: June 8, 2016
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.