Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PH and SEC7 domain-containing protein 3

Gene

Psd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor for ARF6.1 Publication

GO - Molecular functioni

  • ARF guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

  • ARF protein signal transduction Source: MGI
  • regulation of ARF protein signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
PH and SEC7 domain-containing protein 3
Alternative name(s):
Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6
Pleckstrin homology and SEC7 domain-containing protein 3
Gene namesi
Name:Psd3
Synonyms:Efa6d, Kiaa0942
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1918215. Psd3.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • membrane Source: MGI
  • postsynaptic density Source: UniProtKB-SubCell
  • postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10371037PH and SEC7 domain-containing protein 3PRO_0000309454Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei76 – 761PhosphoserineBy similarity
Modified residuei759 – 7591PhosphoserineCombined sources
Modified residuei998 – 9981PhosphoserineCombined sources
Modified residuei1000 – 10001PhosphoserineCombined sources
Modified residuei1001 – 10011PhosphoserineCombined sources
Modified residuei1003 – 10031PhosphoserineCombined sources
Modified residuei1009 – 10091PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ2PFD7.
PaxDbiQ2PFD7.
PeptideAtlasiQ2PFD7.
PRIDEiQ2PFD7.

PTM databases

iPTMnetiQ2PFD7.
PhosphoSiteiQ2PFD7.
SwissPalmiQ2PFD7.

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in liver. Present in brain, with highest levels in olfactory bulb, cortex, hippocampal pyramidal cell layer and cerebellar granule cell layer (at protein level).1 Publication

Developmental stagei

Expressed only in spinal cord at E13. At E18 and P0, appears weakly in forebrain. Expression in brain increases after birth and peaks at P10.1 Publication

Gene expression databases

BgeeiENSMUSG00000030465.
CleanExiMM_PSD3.
ExpressionAtlasiQ2PFD7. baseline and differential.
GenevisibleiQ2PFD7. MM.

Interactioni

Protein-protein interaction databases

BioGridi231513. 1 interaction.
STRINGi10090.ENSMUSP00000096293.

Structurei

3D structure databases

ProteinModelPortaliQ2PFD7.
SMRiQ2PFD7. Positions 577-731, 775-980.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini515 – 723209SEC7PROSITE-ProRule annotationAdd
BLAST
Domaini774 – 887114PHPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili911 – 94131Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SEC7 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0932. Eukaryota.
COG5307. LUCA.
GeneTreeiENSGT00760000119036.
HOGENOMiHOG000115732.
HOVERGENiHBG108299.
InParanoidiQ2PFD7.
KOiK12494.
PhylomeDBiQ2PFD7.
TreeFamiTF319755.

Family and domain databases

Gene3Di1.10.1000.11. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR023394. Sec7_alpha_orthog.
IPR000904. Sec7_dom.
[Graphical view]
PfamiPF01369. Sec7. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00222. Sec7. 1 hit.
[Graphical view]
SUPFAMiSSF48425. SSF48425. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50190. SEC7. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2PFD7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGRNAAAEP FVWVNSASAH SQSVAKAKYE FLFGKSEEKT PDSSDHGGST
60 70 80 90 100
LLPPTVTNEF PEYGTMEEGG EGLRASLDFD AKSPPCRLPG QQAVHLLAGQ
110 120 130 140 150
DSILNSVTEG PNDAPQCHPQ EQSLQPIDSL ISALKATEAR IASGTFQATK
160 170 180 190 200
VLDKDANFSV YQVDKELSTA SHKPQRAHRT FPVGPGKSPD IPLSAEVPTE
210 220 230 240 250
ENLSLHIQED LSALLPEEAQ AHRSQITNYR RQGPLRVPES ACPVSSSSAG
260 270 280 290 300
SHNPVDRVGA LREQRSDLGR EHPRGYDRGG SMGRQGRIKH VEFQGVEILW
310 320 330 340 350
TGEEAESRHP PERTASPVSK EFAKRPSHSS PACGVCSTST HLTGDVWDET
360 370 380 390 400
CKAPSERPGT SAGTLSPMPL GESGEDDVFL RESKEHLEEN FAIQGDKERI
410 420 430 440 450
LDQEEHLRGD DDILGPGYTE DSTDVYSSQF ETILDNTSLY YSAESLETLY
460 470 480 490 500
SEPDSYFSFE MPLTPMIQQR IKEGGQFLER TSVGGQHDVL SVSADGGIVM
510 520 530 540 550
GYSAGITNGL HDSANSVYTR GPQEIAFWGS RDRCFAEGKT TGVDAGSEMG
560 570 580 590 600
STDILEKETT ESLSNGTNSN VEAAKRLAKR LYHLDRFKRS DVAKHLGKNN
610 620 630 640 650
EFSKLVAEEY LKFFDFTGMT LDQSLRYFLK AFSLVGETQE RERVLIHFSN
660 670 680 690 700
RYFSCNPDTI TSKDGVHCLT CAMMLLNTDL HGHVNIGKKM TCQEFITNLQ
710 720 730 740 750
GVNEGGDFSK DLLKALYNSI KNEKLEWAVD DEEKKKSPSE GTDEKANGTH
760 770 780 790 800
PKTISRIGST TNPFLDIPHD PNAAVYKSGF LARKIHADMD GKKTPRGKRG
810 820 830 840 850
WKTFYAVLKG TVLYLQKDEY KPEKSLSDED LKNAVSVHHA LASKATDYEK
860 870 880 890 900
KPNVFKLKTA DWRVLLFQTQ SPEEMQGWIN KINCVAAVFS APPFPAAIGS
910 920 930 940 950
QKKFSRPLLP ATTTKLSQEE QLKSHESKLK QITTELAEHR SYPPDKKVKA
960 970 980 990 1000
KDVDEYKLKD HYLEFEKTRY EIYVSVLKEG GKELLTTDGN EPVGLKKSHS
1010 1020 1030
SPSLNPDASP VTAKVKRNVS ERKDHRPETP GIKQKVT
Length:1,037
Mass (Da):114,722
Last modified:November 13, 2007 - v2
Checksum:iE6E3C240AC7A61E8
GO
Isoform 2 (identifier: Q2PFD7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     684-684: Missing.

Show »
Length:1,036
Mass (Da):114,623
Checksum:i34FF9E2E43BAB2F8
GO
Isoform 3 (identifier: Q2PFD7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     519-530: TRGPQEIAFWGS → MGIIMCLIYCYC
     684-684: Missing.

Show »
Length:518
Mass (Da):58,467
Checksum:iE91589D1EF9433AF
GO
Isoform 4 (identifier: Q2PFD7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     919-966: Missing.

Show »
Length:989
Mass (Da):108,938
Checksum:i42D40BEF95E68601
GO
Isoform 5 (identifier: Q2PFD7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MEGRNAAAEPFVWVNSASAHSQSVAKAKYEFLFGKSEEKTPDSS → MGNCWSYSNLC

Show »
Length:1,004
Mass (Da):111,209
Checksum:iFDD14383335B19FB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti190 – 1901D → E in BAC26065 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 518518Missing in isoform 3. 1 PublicationVSP_029157Add
BLAST
Alternative sequencei1 – 4444MEGRN…TPDSS → MGNCWSYSNLC in isoform 5. 1 PublicationVSP_029158Add
BLAST
Alternative sequencei519 – 53012TRGPQ…AFWGS → MGIIMCLIYCYC in isoform 3. 1 PublicationVSP_029159Add
BLAST
Alternative sequencei684 – 6841Missing in isoform 3 and isoform 2. 1 PublicationVSP_029160
Alternative sequencei919 – 96648Missing in isoform 4. 1 PublicationVSP_029161Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB220685 mRNA. Translation: BAE73186.1.
AK028684 mRNA. Translation: BAC26065.1.
AK161498 mRNA. Translation: BAE36424.1.
AK122405 mRNA. Translation: BAC65687.1.
BC042208 mRNA. Translation: AAH42208.1.
CCDSiCCDS22340.1. [Q2PFD7-3]
CCDS40355.2. [Q2PFD7-5]
RefSeqiNP_081902.1. NM_027626.1.
NP_084539.2. NM_030263.5. [Q2PFD7-3]
NP_808366.2. NM_177698.4. [Q2PFD7-5]
UniGeneiMm.32525.

Genome annotation databases

EnsembliENSMUST00000093468; ENSMUSP00000091178; ENSMUSG00000030465. [Q2PFD7-3]
ENSMUST00000093469; ENSMUSP00000091179; ENSMUSG00000030465. [Q2PFD7-5]
ENSMUST00000098696; ENSMUSP00000096293; ENSMUSG00000030465. [Q2PFD7-5]
GeneIDi234353.
KEGGimmu:234353.
UCSCiuc009lvz.2. mouse. [Q2PFD7-3]
uc009lwc.1. mouse. [Q2PFD7-2]
uc057alt.1. mouse. [Q2PFD7-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB220685 mRNA. Translation: BAE73186.1.
AK028684 mRNA. Translation: BAC26065.1.
AK161498 mRNA. Translation: BAE36424.1.
AK122405 mRNA. Translation: BAC65687.1.
BC042208 mRNA. Translation: AAH42208.1.
CCDSiCCDS22340.1. [Q2PFD7-3]
CCDS40355.2. [Q2PFD7-5]
RefSeqiNP_081902.1. NM_027626.1.
NP_084539.2. NM_030263.5. [Q2PFD7-3]
NP_808366.2. NM_177698.4. [Q2PFD7-5]
UniGeneiMm.32525.

3D structure databases

ProteinModelPortaliQ2PFD7.
SMRiQ2PFD7. Positions 577-731, 775-980.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231513. 1 interaction.
STRINGi10090.ENSMUSP00000096293.

PTM databases

iPTMnetiQ2PFD7.
PhosphoSiteiQ2PFD7.
SwissPalmiQ2PFD7.

Proteomic databases

MaxQBiQ2PFD7.
PaxDbiQ2PFD7.
PeptideAtlasiQ2PFD7.
PRIDEiQ2PFD7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000093468; ENSMUSP00000091178; ENSMUSG00000030465. [Q2PFD7-3]
ENSMUST00000093469; ENSMUSP00000091179; ENSMUSG00000030465. [Q2PFD7-5]
ENSMUST00000098696; ENSMUSP00000096293; ENSMUSG00000030465. [Q2PFD7-5]
GeneIDi234353.
KEGGimmu:234353.
UCSCiuc009lvz.2. mouse. [Q2PFD7-3]
uc009lwc.1. mouse. [Q2PFD7-2]
uc057alt.1. mouse. [Q2PFD7-5]

Organism-specific databases

CTDi23362.
MGIiMGI:1918215. Psd3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0932. Eukaryota.
COG5307. LUCA.
GeneTreeiENSGT00760000119036.
HOGENOMiHOG000115732.
HOVERGENiHBG108299.
InParanoidiQ2PFD7.
KOiK12494.
PhylomeDBiQ2PFD7.
TreeFamiTF319755.

Miscellaneous databases

PROiQ2PFD7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030465.
CleanExiMM_PSD3.
ExpressionAtlasiQ2PFD7. baseline and differential.
GenevisibleiQ2PFD7. MM.

Family and domain databases

Gene3Di1.10.1000.11. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR023394. Sec7_alpha_orthog.
IPR000904. Sec7_dom.
[Graphical view]
PfamiPF01369. Sec7. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00222. Sec7. 1 hit.
[Graphical view]
SUPFAMiSSF48425. SSF48425. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50190. SEC7. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPSD3_MOUSE
AccessioniPrimary (citable) accession number: Q2PFD7
Secondary accession number(s): Q3TTA1
, Q80TN6, Q80UZ7, Q8CEA6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: September 7, 2016
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.