Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q2MV58

- TECT1_HUMAN

UniProt

Q2MV58 - TECT1_HUMAN

Protein

Tectonic-1

Gene

TCTN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 70 (01 Oct 2014)
      Sequence version 2 (04 Apr 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Regulator of Hedgehog (Hh), required for both activation and inhibition of the Hh pathway in the patterning of the neural tube. During neural tube development, it is required for formation of the most ventral cell types and for full Hh pathway activation. Functions in Hh signal transduction to fully activate the pathway in the presence of high Hh levels and to repress the pathway in the absence of Hh signals. Modulates Hh signal transduction downstream of SMO and RAB23 By similarity.By similarity

    GO - Biological processi

    1. central nervous system interneuron axonogenesis Source: Ensembl
    2. cilium morphogenesis Source: UniProtKB
    3. dorsal/ventral neural tube patterning Source: Ensembl
    4. in utero embryonic development Source: Ensembl
    5. neural tube formation Source: Ensembl
    6. regulation of smoothened signaling pathway Source: Ensembl
    7. somatic motor neuron differentiation Source: Ensembl
    8. telencephalon development Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Cilium biogenesis/degradation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tectonic-1
    Gene namesi
    Name:TCTN1
    Synonyms:TECT1
    ORF Names:UNQ9369/PRO34160
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:26113. TCTN1.

    Subcellular locationi

    Cytoplasmcytoskeletoncilium basal body By similarity. Secreted Curated
    Note: Despite the presence of a signal sequence, the full length protein might not be secreted. Localizes at the transition zone, a region between the basal body and the ciliary axoneme.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-KW
    2. cytoskeleton Source: UniProtKB-KW
    3. extracellular space Source: Ensembl
    4. membrane Source: Ensembl
    5. TCTN-B9D complex Source: UniProtKB

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Cytoskeleton, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Joubert syndrome 13 (JBTS13) [MIM:614173]: A disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Keywords - Diseasei

    Ciliopathy, Joubert syndrome

    Organism-specific databases

    MIMi614173. phenotype.
    Orphaneti475. Joubert syndrome.
    PharmGKBiPA162405437.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2222Sequence AnalysisAdd
    BLAST
    Chaini23 – 587565Tectonic-1PRO_0000229796Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi295 – 2951N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi528 – 5281N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ2MV58.
    PaxDbiQ2MV58.
    PRIDEiQ2MV58.

    Expressioni

    Gene expression databases

    ArrayExpressiQ2MV58.
    BgeeiQ2MV58.
    CleanExiHS_TCTN1.
    GenevestigatoriQ2MV58.

    Organism-specific databases

    HPAiHPA039687.
    HPA040036.

    Interactioni

    Subunit structurei

    Part of the tectonic-like complex (also named B9 complex).By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000380779.

    Structurei

    3D structure databases

    ProteinModelPortaliQ2MV58.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi78 – 9720Cys-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the tectonic family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG77647.
    HOVERGENiHBG083755.
    OMAiTTNRYGQ.
    OrthoDBiEOG7S4X62.
    PhylomeDBiQ2MV58.
    TreeFamiTF329169.

    Family and domain databases

    InterProiIPR011677. DUF1619.
    [Graphical view]
    PfamiPF07773. DUF1619. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q2MV58-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRPRGLPPLL VVLLGCWASV SAQTDATPAV TTEGLNSTEA ALATFGTFPS    50
    TRPPGTPRAP GPSSGPRPTP VTDVAVLCVC DLSPAQCDIN CCCDPDCSSV 100
    DFSVFSACSV PVVTGDSQFC SQKAVIYSLN FTANPPQRVF ELVDQINPSI 150
    FCIHITNYKP ALSFINPEVP DENNFDTLMK TSDGFTLNAE SYVSFTTKLD 200
    IPTAAKYEYG VPLQTSDSFL RFPSSLTSSL CTDNNPAAFL VNQAVKCTRK 250
    INLEQCEEIE ALSMAFYSSP EILRVPDSRK KVPITVQSIV IQSLNKTLTR 300
    REDTDVLQPT LVNAGHFSLC VNVVLEVKYS LTYTDAGEVT KADLSFVLGT 350
    VSSVVVPLQQ KFEIHFLQEN TQPVPLSGNP GYVVGLPLAA GFQPHKGSGI 400
    IQTTNRYGQL TILHSTTEQD CLALEGVRTP VLFGYTMQSG CKLRLTGALP 450
    CQLVAQKVKS LLWGQGFPDY VAPFGNSQAQ DMLDWVPIHF ITQSFNRKDS 500
    CQLPGALVIE VKWTKYGSLL NPQAKIVNVT ANLISSSFPE ANSGNERTIL 550
    ISTAVTFVDV SAPAEAGFRA PPAINARLPF NFFFPFV 587
    Length:587
    Mass (Da):63,570
    Last modified:April 4, 2006 - v2
    Checksum:i0FFAD006E3B9160D
    GO
    Isoform 2 (identifier: Q2MV58-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         498-498: K → KHFVLQ

    Show »
    Length:592
    Mass (Da):64,194
    Checksum:i7A7452307CFF9844
    GO
    Isoform 3 (identifier: Q2MV58-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         238-274: AFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILR → GQAYWFTPVIPALWEAEARGSLE

    Show »
    Length:573
    Mass (Da):61,916
    Checksum:i8D6DE4B551763306
    GO
    Isoform 4 (identifier: Q2MV58-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MRPRGLPPLL...SGPRPTPVTD → MCQLLESTVIQPQGDSP

    Show »
    Length:531
    Mass (Da):58,018
    Checksum:i18BBEC27ECCE3B12
    GO
    Isoform 5 (identifier: Q2MV58-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MRPRGLPPLL...SGPRPTPVTD → MITAHCGLDLLGS
         398-446: Missing.
         498-498: K → KHFVLQ

    Show »
    Length:483
    Mass (Da):52,729
    Checksum:iBF71AD96270313DB
    GO
    Isoform 6 (identifier: Q2MV58-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-178: Missing.
         369-438: ENTQPVPLSG...TPVLFGYTMQ → TDWSSPVSAR...RGFGYRSEVD
         439-587: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Show »
    Length:260
    Mass (Da):28,532
    Checksum:i6396F9FB6AE91F2C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti14 – 141L → M in AAQ88551. (PubMed:12975309)Curated
    Sequence conflicti330 – 3301S → T in ABB90560. (PubMed:16357211)Curated
    Sequence conflicti341 – 3411K → E in BAB15000. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 178178Missing in isoform 6. 1 PublicationVSP_017756Add
    BLAST
    Alternative sequencei1 – 7373MRPRG…TPVTD → MCQLLESTVIQPQGDSP in isoform 4. 1 PublicationVSP_017757Add
    BLAST
    Alternative sequencei1 – 7373MRPRG…TPVTD → MITAHCGLDLLGS in isoform 5. 1 PublicationVSP_017758Add
    BLAST
    Alternative sequencei238 – 27437AFLVN…PEILR → GQAYWFTPVIPALWEAEARG SLE in isoform 3. 2 PublicationsVSP_017759Add
    BLAST
    Alternative sequencei369 – 43870ENTQP…GYTMQ → TDWSSPVSARSTEGEEPAVG PGLPRLRGPFWKFPGPGHAG LGAHPLHHPVIQQEGFLPAP RGFGYRSEVD in isoform 6. 1 PublicationVSP_017760Add
    BLAST
    Alternative sequencei398 – 44649Missing in isoform 5. 1 PublicationVSP_017761Add
    BLAST
    Alternative sequencei439 – 587149Missing in isoform 6. 1 PublicationVSP_017762Add
    BLAST
    Alternative sequencei498 – 4981K → KHFVLQ in isoform 2 and isoform 5. 2 PublicationsVSP_017763

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ278868 mRNA. Translation: ABB90560.1.
    AY358184 mRNA. Translation: AAQ88551.1.
    AK024780 mRNA. Translation: BAB15000.1.
    AK055891 mRNA. Translation: BAB71036.1.
    AK092775 mRNA. Translation: BAC03973.1.
    AC002350 Genomic DNA. No translation available.
    AC144522 Genomic DNA. No translation available.
    BC040113 mRNA. Translation: AAH40113.1.
    BC044885 mRNA. No translation available.
    BC062611 mRNA. Translation: AAH62611.1.
    CCDSiCCDS41833.1. [Q2MV58-3]
    CCDS41834.1. [Q2MV58-2]
    CCDS41835.1. [Q2MV58-1]
    RefSeqiNP_001076006.1. NM_001082537.2. [Q2MV58-1]
    NP_001076007.1. NM_001082538.2. [Q2MV58-2]
    NP_001167446.1. NM_001173975.1. [Q2MV58-4]
    NP_001167447.1. NM_001173976.1.
    NP_078825.2. NM_024549.5. [Q2MV58-3]
    UniGeneiHs.211511.

    Genome annotation databases

    EnsembliENST00000377654; ENSP00000366882; ENSG00000204852. [Q2MV58-6]
    ENST00000397655; ENSP00000380775; ENSG00000204852. [Q2MV58-3]
    ENST00000397659; ENSP00000380779; ENSG00000204852. [Q2MV58-2]
    ENST00000551590; ENSP00000448735; ENSG00000204852. [Q2MV58-1]
    GeneIDi79600.
    KEGGihsa:79600.
    UCSCiuc001trj.2. human. [Q2MV58-4]
    uc001trm.3. human. [Q2MV58-5]
    uc001trn.4. human. [Q2MV58-2]
    uc001trp.4. human. [Q2MV58-3]
    uc009zvs.3. human. [Q2MV58-1]

    Polymorphism databases

    DMDMi91208022.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ278868 mRNA. Translation: ABB90560.1 .
    AY358184 mRNA. Translation: AAQ88551.1 .
    AK024780 mRNA. Translation: BAB15000.1 .
    AK055891 mRNA. Translation: BAB71036.1 .
    AK092775 mRNA. Translation: BAC03973.1 .
    AC002350 Genomic DNA. No translation available.
    AC144522 Genomic DNA. No translation available.
    BC040113 mRNA. Translation: AAH40113.1 .
    BC044885 mRNA. No translation available.
    BC062611 mRNA. Translation: AAH62611.1 .
    CCDSi CCDS41833.1. [Q2MV58-3 ]
    CCDS41834.1. [Q2MV58-2 ]
    CCDS41835.1. [Q2MV58-1 ]
    RefSeqi NP_001076006.1. NM_001082537.2. [Q2MV58-1 ]
    NP_001076007.1. NM_001082538.2. [Q2MV58-2 ]
    NP_001167446.1. NM_001173975.1. [Q2MV58-4 ]
    NP_001167447.1. NM_001173976.1.
    NP_078825.2. NM_024549.5. [Q2MV58-3 ]
    UniGenei Hs.211511.

    3D structure databases

    ProteinModelPortali Q2MV58.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000380779.

    Polymorphism databases

    DMDMi 91208022.

    Proteomic databases

    MaxQBi Q2MV58.
    PaxDbi Q2MV58.
    PRIDEi Q2MV58.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000377654 ; ENSP00000366882 ; ENSG00000204852 . [Q2MV58-6 ]
    ENST00000397655 ; ENSP00000380775 ; ENSG00000204852 . [Q2MV58-3 ]
    ENST00000397659 ; ENSP00000380779 ; ENSG00000204852 . [Q2MV58-2 ]
    ENST00000551590 ; ENSP00000448735 ; ENSG00000204852 . [Q2MV58-1 ]
    GeneIDi 79600.
    KEGGi hsa:79600.
    UCSCi uc001trj.2. human. [Q2MV58-4 ]
    uc001trm.3. human. [Q2MV58-5 ]
    uc001trn.4. human. [Q2MV58-2 ]
    uc001trp.4. human. [Q2MV58-3 ]
    uc009zvs.3. human. [Q2MV58-1 ]

    Organism-specific databases

    CTDi 79600.
    GeneCardsi GC12P111051.
    GeneReviewsi TCTN1.
    HGNCi HGNC:26113. TCTN1.
    HPAi HPA039687.
    HPA040036.
    MIMi 609863. gene.
    614173. phenotype.
    neXtProti NX_Q2MV58.
    Orphaneti 475. Joubert syndrome.
    PharmGKBi PA162405437.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG77647.
    HOVERGENi HBG083755.
    OMAi TTNRYGQ.
    OrthoDBi EOG7S4X62.
    PhylomeDBi Q2MV58.
    TreeFami TF329169.

    Miscellaneous databases

    GenomeRNAii 79600.
    NextBioi 68626.
    PROi Q2MV58.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q2MV58.
    Bgeei Q2MV58.
    CleanExi HS_TCTN1.
    Genevestigatori Q2MV58.

    Family and domain databases

    InterProi IPR011677. DUF1619.
    [Graphical view ]
    Pfami PF07773. DUF1619. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition."
      Reiter J.F., Skarnes W.C.
      Genes Dev. 20:22-27(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
      Tissue: Artery smooth muscle, Mammary gland and Small intestine.
    4. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6).
      Tissue: Pancreas and Testis.
    6. Cited for: INVOLVEMENT IN JBTS13, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiTECT1_HUMAN
    AccessioniPrimary (citable) accession number: Q2MV58
    Secondary accession number(s): A8MX11
    , Q49A60, Q6P5X1, Q6UXW2, Q8NAE9, Q96N72, Q9H798
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 4, 2006
    Last sequence update: April 4, 2006
    Last modified: October 1, 2014
    This is version 70 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3