Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q2MV58

- TECT1_HUMAN

UniProt

Q2MV58 - TECT1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tectonic-1

Gene

TCTN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Regulator of Hedgehog (Hh), required for both activation and inhibition of the Hh pathway in the patterning of the neural tube. During neural tube development, it is required for formation of the most ventral cell types and for full Hh pathway activation. Functions in Hh signal transduction to fully activate the pathway in the presence of high Hh levels and to repress the pathway in the absence of Hh signals. Modulates Hh signal transduction downstream of SMO and RAB23 (By similarity).By similarity

GO - Biological processi

  1. central nervous system interneuron axonogenesis Source: Ensembl
  2. cilium morphogenesis Source: UniProtKB
  3. dorsal/ventral neural tube patterning Source: Ensembl
  4. in utero embryonic development Source: Ensembl
  5. neural tube formation Source: Ensembl
  6. regulation of smoothened signaling pathway Source: Ensembl
  7. somatic motor neuron differentiation Source: Ensembl
  8. telencephalon development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Tectonic-1
Gene namesi
Name:TCTN1
Synonyms:TECT1
ORF Names:UNQ9369/PRO34160
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:26113. TCTN1.

Subcellular locationi

Cytoplasmcytoskeletoncilium basal body By similarity. Secreted Curated
Note: Despite the presence of a signal sequence, the full length protein might not be secreted. Localizes at the transition zone, a region between the basal body and the ciliary axoneme.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. membrane Source: Ensembl
  5. TCTN-B9D complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Secreted

Pathology & Biotechi

Involvement in diseasei

Joubert syndrome 13 (JBTS13) [MIM:614173]: A disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.

Keywords - Diseasei

Ciliopathy, Joubert syndrome

Organism-specific databases

MIMi614173. phenotype.
Orphaneti475. Joubert syndrome.
PharmGKBiPA162405437.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Chaini23 – 587565Tectonic-1PRO_0000229796Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi295 – 2951N-linked (GlcNAc...)Sequence Analysis
Glycosylationi528 – 5281N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ2MV58.
PaxDbiQ2MV58.
PRIDEiQ2MV58.

Expressioni

Gene expression databases

BgeeiQ2MV58.
CleanExiHS_TCTN1.
ExpressionAtlasiQ2MV58. baseline and differential.
GenevestigatoriQ2MV58.

Organism-specific databases

HPAiHPA039687.
HPA040036.

Interactioni

Subunit structurei

Part of the tectonic-like complex (also named B9 complex).By similarity

Protein-protein interaction databases

BioGridi122738. 5 interactions.
STRINGi9606.ENSP00000380779.

Structurei

3D structure databases

ProteinModelPortaliQ2MV58.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi78 – 9720Cys-richAdd
BLAST

Sequence similaritiesi

Belongs to the tectonic family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG77647.
GeneTreeiENSGT00570000079101.
HOVERGENiHBG083755.
InParanoidiQ2MV58.
OMAiTTNRYGQ.
OrthoDBiEOG7S4X62.
PhylomeDBiQ2MV58.
TreeFamiTF329169.

Family and domain databases

InterProiIPR011677. DUF1619.
[Graphical view]
PfamiPF07773. DUF1619. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q2MV58) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPRGLPPLL VVLLGCWASV SAQTDATPAV TTEGLNSTEA ALATFGTFPS
60 70 80 90 100
TRPPGTPRAP GPSSGPRPTP VTDVAVLCVC DLSPAQCDIN CCCDPDCSSV
110 120 130 140 150
DFSVFSACSV PVVTGDSQFC SQKAVIYSLN FTANPPQRVF ELVDQINPSI
160 170 180 190 200
FCIHITNYKP ALSFINPEVP DENNFDTLMK TSDGFTLNAE SYVSFTTKLD
210 220 230 240 250
IPTAAKYEYG VPLQTSDSFL RFPSSLTSSL CTDNNPAAFL VNQAVKCTRK
260 270 280 290 300
INLEQCEEIE ALSMAFYSSP EILRVPDSRK KVPITVQSIV IQSLNKTLTR
310 320 330 340 350
REDTDVLQPT LVNAGHFSLC VNVVLEVKYS LTYTDAGEVT KADLSFVLGT
360 370 380 390 400
VSSVVVPLQQ KFEIHFLQEN TQPVPLSGNP GYVVGLPLAA GFQPHKGSGI
410 420 430 440 450
IQTTNRYGQL TILHSTTEQD CLALEGVRTP VLFGYTMQSG CKLRLTGALP
460 470 480 490 500
CQLVAQKVKS LLWGQGFPDY VAPFGNSQAQ DMLDWVPIHF ITQSFNRKDS
510 520 530 540 550
CQLPGALVIE VKWTKYGSLL NPQAKIVNVT ANLISSSFPE ANSGNERTIL
560 570 580
ISTAVTFVDV SAPAEAGFRA PPAINARLPF NFFFPFV
Length:587
Mass (Da):63,570
Last modified:April 4, 2006 - v2
Checksum:i0FFAD006E3B9160D
GO
Isoform 2 (identifier: Q2MV58-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     498-498: K → KHFVLQ

Show »
Length:592
Mass (Da):64,194
Checksum:i7A7452307CFF9844
GO
Isoform 3 (identifier: Q2MV58-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-274: AFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILR → GQAYWFTPVIPALWEAEARGSLE

Show »
Length:573
Mass (Da):61,916
Checksum:i8D6DE4B551763306
GO
Isoform 4 (identifier: Q2MV58-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MRPRGLPPLL...SGPRPTPVTD → MCQLLESTVIQPQGDSP

Show »
Length:531
Mass (Da):58,018
Checksum:i18BBEC27ECCE3B12
GO
Isoform 5 (identifier: Q2MV58-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MRPRGLPPLL...SGPRPTPVTD → MITAHCGLDLLGS
     398-446: Missing.
     498-498: K → KHFVLQ

Show »
Length:483
Mass (Da):52,729
Checksum:iBF71AD96270313DB
GO
Isoform 6 (identifier: Q2MV58-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-178: Missing.
     369-438: ENTQPVPLSG...TPVLFGYTMQ → TDWSSPVSAR...RGFGYRSEVD
     439-587: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:260
Mass (Da):28,532
Checksum:i6396F9FB6AE91F2C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 141L → M in AAQ88551. (PubMed:12975309)Curated
Sequence conflicti330 – 3301S → T in ABB90560. (PubMed:16357211)Curated
Sequence conflicti341 – 3411K → E in BAB15000. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 178178Missing in isoform 6. 1 PublicationVSP_017756Add
BLAST
Alternative sequencei1 – 7373MRPRG…TPVTD → MCQLLESTVIQPQGDSP in isoform 4. 1 PublicationVSP_017757Add
BLAST
Alternative sequencei1 – 7373MRPRG…TPVTD → MITAHCGLDLLGS in isoform 5. 1 PublicationVSP_017758Add
BLAST
Alternative sequencei238 – 27437AFLVN…PEILR → GQAYWFTPVIPALWEAEARG SLE in isoform 3. 2 PublicationsVSP_017759Add
BLAST
Alternative sequencei369 – 43870ENTQP…GYTMQ → TDWSSPVSARSTEGEEPAVG PGLPRLRGPFWKFPGPGHAG LGAHPLHHPVIQQEGFLPAP RGFGYRSEVD in isoform 6. 1 PublicationVSP_017760Add
BLAST
Alternative sequencei398 – 44649Missing in isoform 5. 1 PublicationVSP_017761Add
BLAST
Alternative sequencei439 – 587149Missing in isoform 6. 1 PublicationVSP_017762Add
BLAST
Alternative sequencei498 – 4981K → KHFVLQ in isoform 2 and isoform 5. 2 PublicationsVSP_017763

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ278868 mRNA. Translation: ABB90560.1.
AY358184 mRNA. Translation: AAQ88551.1.
AK024780 mRNA. Translation: BAB15000.1.
AK055891 mRNA. Translation: BAB71036.1.
AK092775 mRNA. Translation: BAC03973.1.
AC002350 Genomic DNA. No translation available.
AC144522 Genomic DNA. No translation available.
BC040113 mRNA. Translation: AAH40113.1.
BC044885 mRNA. No translation available.
BC062611 mRNA. Translation: AAH62611.1.
CCDSiCCDS41833.1. [Q2MV58-3]
CCDS41834.1. [Q2MV58-2]
CCDS41835.1. [Q2MV58-1]
RefSeqiNP_001076006.1. NM_001082537.2. [Q2MV58-1]
NP_001076007.1. NM_001082538.2. [Q2MV58-2]
NP_001167446.1. NM_001173975.1. [Q2MV58-4]
NP_001167447.1. NM_001173976.1.
NP_078825.2. NM_024549.5. [Q2MV58-3]
UniGeneiHs.211511.

Genome annotation databases

EnsembliENST00000397655; ENSP00000380775; ENSG00000204852. [Q2MV58-3]
ENST00000397659; ENSP00000380779; ENSG00000204852. [Q2MV58-2]
ENST00000551590; ENSP00000448735; ENSG00000204852. [Q2MV58-1]
GeneIDi79600.
KEGGihsa:79600.
UCSCiuc001trj.2. human. [Q2MV58-4]
uc001trm.3. human. [Q2MV58-5]
uc001trn.4. human. [Q2MV58-2]
uc001trp.4. human. [Q2MV58-3]
uc009zvs.3. human. [Q2MV58-1]

Polymorphism databases

DMDMi91208022.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ278868 mRNA. Translation: ABB90560.1 .
AY358184 mRNA. Translation: AAQ88551.1 .
AK024780 mRNA. Translation: BAB15000.1 .
AK055891 mRNA. Translation: BAB71036.1 .
AK092775 mRNA. Translation: BAC03973.1 .
AC002350 Genomic DNA. No translation available.
AC144522 Genomic DNA. No translation available.
BC040113 mRNA. Translation: AAH40113.1 .
BC044885 mRNA. No translation available.
BC062611 mRNA. Translation: AAH62611.1 .
CCDSi CCDS41833.1. [Q2MV58-3 ]
CCDS41834.1. [Q2MV58-2 ]
CCDS41835.1. [Q2MV58-1 ]
RefSeqi NP_001076006.1. NM_001082537.2. [Q2MV58-1 ]
NP_001076007.1. NM_001082538.2. [Q2MV58-2 ]
NP_001167446.1. NM_001173975.1. [Q2MV58-4 ]
NP_001167447.1. NM_001173976.1.
NP_078825.2. NM_024549.5. [Q2MV58-3 ]
UniGenei Hs.211511.

3D structure databases

ProteinModelPortali Q2MV58.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122738. 5 interactions.
STRINGi 9606.ENSP00000380779.

Polymorphism databases

DMDMi 91208022.

Proteomic databases

MaxQBi Q2MV58.
PaxDbi Q2MV58.
PRIDEi Q2MV58.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000397655 ; ENSP00000380775 ; ENSG00000204852 . [Q2MV58-3 ]
ENST00000397659 ; ENSP00000380779 ; ENSG00000204852 . [Q2MV58-2 ]
ENST00000551590 ; ENSP00000448735 ; ENSG00000204852 . [Q2MV58-1 ]
GeneIDi 79600.
KEGGi hsa:79600.
UCSCi uc001trj.2. human. [Q2MV58-4 ]
uc001trm.3. human. [Q2MV58-5 ]
uc001trn.4. human. [Q2MV58-2 ]
uc001trp.4. human. [Q2MV58-3 ]
uc009zvs.3. human. [Q2MV58-1 ]

Organism-specific databases

CTDi 79600.
GeneCardsi GC12P111051.
GeneReviewsi TCTN1.
HGNCi HGNC:26113. TCTN1.
HPAi HPA039687.
HPA040036.
MIMi 609863. gene.
614173. phenotype.
neXtProti NX_Q2MV58.
Orphaneti 475. Joubert syndrome.
PharmGKBi PA162405437.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG77647.
GeneTreei ENSGT00570000079101.
HOVERGENi HBG083755.
InParanoidi Q2MV58.
OMAi TTNRYGQ.
OrthoDBi EOG7S4X62.
PhylomeDBi Q2MV58.
TreeFami TF329169.

Miscellaneous databases

GenomeRNAii 79600.
NextBioi 68626.
PROi Q2MV58.
SOURCEi Search...

Gene expression databases

Bgeei Q2MV58.
CleanExi HS_TCTN1.
ExpressionAtlasi Q2MV58. baseline and differential.
Genevestigatori Q2MV58.

Family and domain databases

InterProi IPR011677. DUF1619.
[Graphical view ]
Pfami PF07773. DUF1619. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition."
    Reiter J.F., Skarnes W.C.
    Genes Dev. 20:22-27(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
    Tissue: Artery smooth muscle, Mammary gland and Small intestine.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6).
    Tissue: Pancreas and Testis.
  6. Cited for: INVOLVEMENT IN JBTS13, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiTECT1_HUMAN
AccessioniPrimary (citable) accession number: Q2MV58
Secondary accession number(s): A8MX11
, Q49A60, Q6P5X1, Q6UXW2, Q8NAE9, Q96N72, Q9H798
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: April 4, 2006
Last modified: October 29, 2014
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3