Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q2MKA5

- ACHA5_MOUSE

UniProt

Q2MKA5 - ACHA5_MOUSE

Protein

Neuronal acetylcholine receptor subunit alpha-5

Gene

Chrna5

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 75 (01 Oct 2014)
      Sequence version 1 (07 Feb 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.By similarity

    GO - Molecular functioni

    1. acetylcholine-activated cation-selective channel activity Source: InterPro
    2. acetylcholine receptor activity Source: Ensembl

    GO - Biological processi

    1. behavioral response to nicotine Source: Ensembl
    2. response to nicotine Source: MGI

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_198583. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
    REACT_198585. Highly calcium permeable nicotinic acetylcholine receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neuronal acetylcholine receptor subunit alpha-5
    Gene namesi
    Name:Chrna5
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:87889. Chrna5.

    Subcellular locationi

    GO - Cellular componenti

    1. acetylcholine-gated channel complex Source: MGI
    2. cell junction Source: UniProtKB-KW
    3. postsynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 467438Neuronal acetylcholine receptor subunit alpha-5PRO_0000304938Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi155 – 1551N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi170 ↔ 184By similarity
    Glycosylationi183 – 1831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi229 – 2291N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi234 ↔ 235Associated with receptor activationBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ2MKA5.

    PTM databases

    PhosphoSiteiQ2MKA5.

    Expressioni

    Gene expression databases

    BgeeiQ2MKA5.
    GenevestigatoriQ2MKA5.

    Interactioni

    Subunit structurei

    Neuronal AChR seems to be composed of two different type of subunits: alpha and non-alpha (beta).By similarity

    Protein-protein interaction databases

    BioGridi225945. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ2MKA5.
    SMRiQ2MKA5. Positions 44-446.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini338 – 42992CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini451 – 46717ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei255 – 27521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei284 – 30421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei317 – 33721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei430 – 45021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG267611.
    GeneTreeiENSGT00750000117712.
    HOGENOMiHOG000006756.
    HOVERGENiHBG003756.
    InParanoidiQ2MKA5.
    KOiK04807.
    OMAiKQEWVDV.
    OrthoDBiEOG72JWGV.
    PhylomeDBiQ2MKA5.
    TreeFamiTF315605.

    Family and domain databases

    Gene3Di1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProiIPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    IPR002394. Nicotinic_acetylcholine_rcpt.
    [Graphical view]
    PANTHERiPTHR18945. PTHR18945. 1 hit.
    PfamiPF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 2 hits.
    [Graphical view]
    PRINTSiPR00254. NICOTINICR.
    PR00252. NRIONCHANNEL.
    SUPFAMiSSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsiTIGR00860. LIC. 1 hit.
    PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q2MKA5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAARGSRRRA LRLLLMVQLL AGRWRPAGAA RGARGGLPEL SSAAKHEDSL    50
    FRDLFEDYEK WVRPVEHLSD KIKIKFGLAI SQLVDVDEKN QLMTTNVWLK 100
    QEWIDVKLRW NPDDYGGIKI IRVPSDSLWI PDIVLFDNAD GRFEGASTKT 150
    VVRYNGTVTW TQPANYKSSC TIDVTFFPFD LQNCSMKFGS WTYDGSQVDI 200
    ILEDQDVDRT DFFDNGEWEI MSAMGSKGNR TDSCCWYPCI TYSFVIKRLP 250
    LFYTLFLIIP CIGLSFLTVV VFYLPSNEGE KISLCTSVLV SLTVFLLVIE 300
    EIIPSSSKVI PLIGEYLVFT MIFVTLSIMV TVFAINIHHR SSSTHNAMAP 350
    WVRKIFLHKL PKLLCMRSHA DRYFTQREEA EKDGGPKSRN TLEAALDCIR 400
    YITRHVVKEN DVREVVEDWK FIAQVLDRMF LWTFLLVSII GTLGLFVPVI 450
    YKWANIIVPV HIGNTIK 467
    Length:467
    Mass (Da):53,448
    Last modified:February 7, 2006 - v1
    Checksum:i8F5BBA03D6191BA8
    GO
    Isoform 2 (identifier: Q2MKA5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MAARGSRRRALRLLLMVQLLAGRWRPAGAARGARG → MQISNA

    Show »
    Length:438
    Mass (Da):50,294
    Checksum:i20E24D19C4A93483
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MAARG…RGARG → MQISNA in isoform 2. 2 PublicationsVSP_028132Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY574264 mRNA. Translation: AAS90360.1.
    DQ318788 mRNA. Translation: ABC49856.1.
    BC106853 mRNA. Translation: AAI06854.1.
    CCDSiCCDS52800.1. [Q2MKA5-2]
    RefSeqiNP_789814.2. NM_176844.4. [Q2MKA5-2]
    XP_006510836.1. XM_006510773.1. [Q2MKA5-1]
    UniGeneiMm.103778.

    Genome annotation databases

    EnsembliENSMUST00000093844; ENSMUSP00000091365; ENSMUSG00000035594. [Q2MKA5-2]
    GeneIDi110835.
    KEGGimmu:110835.
    UCSCiuc009prv.2. mouse. [Q2MKA5-2]
    uc009prw.2. mouse. [Q2MKA5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY574264 mRNA. Translation: AAS90360.1 .
    DQ318788 mRNA. Translation: ABC49856.1 .
    BC106853 mRNA. Translation: AAI06854.1 .
    CCDSi CCDS52800.1. [Q2MKA5-2 ]
    RefSeqi NP_789814.2. NM_176844.4. [Q2MKA5-2 ]
    XP_006510836.1. XM_006510773.1. [Q2MKA5-1 ]
    UniGenei Mm.103778.

    3D structure databases

    ProteinModelPortali Q2MKA5.
    SMRi Q2MKA5. Positions 44-446.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 225945. 2 interactions.

    Chemistry

    GuidetoPHARMACOLOGYi 466.

    PTM databases

    PhosphoSitei Q2MKA5.

    Proteomic databases

    PRIDEi Q2MKA5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000093844 ; ENSMUSP00000091365 ; ENSMUSG00000035594 . [Q2MKA5-2 ]
    GeneIDi 110835.
    KEGGi mmu:110835.
    UCSCi uc009prv.2. mouse. [Q2MKA5-2 ]
    uc009prw.2. mouse. [Q2MKA5-1 ]

    Organism-specific databases

    CTDi 1138.
    MGIi MGI:87889. Chrna5.

    Phylogenomic databases

    eggNOGi NOG267611.
    GeneTreei ENSGT00750000117712.
    HOGENOMi HOG000006756.
    HOVERGENi HBG003756.
    InParanoidi Q2MKA5.
    KOi K04807.
    OMAi KQEWVDV.
    OrthoDBi EOG72JWGV.
    PhylomeDBi Q2MKA5.
    TreeFami TF315605.

    Enzyme and pathway databases

    Reactomei REACT_198583. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
    REACT_198585. Highly calcium permeable nicotinic acetylcholine receptors.

    Miscellaneous databases

    NextBioi 364755.
    PROi Q2MKA5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q2MKA5.
    Genevestigatori Q2MKA5.

    Family and domain databases

    Gene3Di 1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProi IPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    IPR002394. Nicotinic_acetylcholine_rcpt.
    [Graphical view ]
    PANTHERi PTHR18945. PTHR18945. 1 hit.
    Pfami PF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 2 hits.
    [Graphical view ]
    PRINTSi PR00254. NICOTINICR.
    PR00252. NRIONCHANNEL.
    SUPFAMi SSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsi TIGR00860. LIC. 1 hit.
    PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Groot-Kormelink P.J.
      Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: BALB/c.
      Tissue: Brain.
    2. VanEngelenburg S., Stitzel J.A.
      Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiACHA5_MOUSE
    AccessioniPrimary (citable) accession number: Q2MKA5
    Secondary accession number(s): Q6PW45
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: February 7, 2006
    Last modified: October 1, 2014
    This is version 75 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3