Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q2MKA5 (ACHA5_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neuronal acetylcholine receptor subunit alpha-5
Gene names
Name:Chrna5
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length467 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane By similarity.

Subunit structure

Neuronal AChR seems to be composed of two different type of subunits: alpha and non-alpha (beta) By similarity.

Subcellular location

Cell junctionsynapsepostsynaptic cell membrane; Multi-pass membrane protein By similarity. Cell membrane; Multi-pass membrane protein By similarity.

Sequence similarities

Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily. [View classification]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q2MKA5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q2MKA5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAARGSRRRALRLLLMVQLLAGRWRPAGAARGARG → MQISNA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 467438Neuronal acetylcholine receptor subunit alpha-5
PRO_0000304938

Regions

Transmembrane255 – 27521Helical; Potential
Transmembrane284 – 30421Helical; Potential
Transmembrane317 – 33721Helical; Potential
Topological domain338 – 42992Cytoplasmic Potential
Transmembrane430 – 45021Helical; Potential
Topological domain451 – 46717Extracellular Potential

Amino acid modifications

Glycosylation1551N-linked (GlcNAc...) Potential
Glycosylation1831N-linked (GlcNAc...) Potential
Glycosylation2291N-linked (GlcNAc...) Potential
Disulfide bond170 ↔ 184 By similarity
Disulfide bond234 ↔ 235Associated with receptor activation By similarity

Natural variations

Alternative sequence1 – 3535MAARG…RGARG → MQISNA in isoform 2.
VSP_028132

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 7, 2006. Version 1.
Checksum: 8F5BBA03D6191BA8

FASTA46753,448
        10         20         30         40         50         60 
MAARGSRRRA LRLLLMVQLL AGRWRPAGAA RGARGGLPEL SSAAKHEDSL FRDLFEDYEK 

        70         80         90        100        110        120 
WVRPVEHLSD KIKIKFGLAI SQLVDVDEKN QLMTTNVWLK QEWIDVKLRW NPDDYGGIKI 

       130        140        150        160        170        180 
IRVPSDSLWI PDIVLFDNAD GRFEGASTKT VVRYNGTVTW TQPANYKSSC TIDVTFFPFD 

       190        200        210        220        230        240 
LQNCSMKFGS WTYDGSQVDI ILEDQDVDRT DFFDNGEWEI MSAMGSKGNR TDSCCWYPCI 

       250        260        270        280        290        300 
TYSFVIKRLP LFYTLFLIIP CIGLSFLTVV VFYLPSNEGE KISLCTSVLV SLTVFLLVIE 

       310        320        330        340        350        360 
EIIPSSSKVI PLIGEYLVFT MIFVTLSIMV TVFAINIHHR SSSTHNAMAP WVRKIFLHKL 

       370        380        390        400        410        420 
PKLLCMRSHA DRYFTQREEA EKDGGPKSRN TLEAALDCIR YITRHVVKEN DVREVVEDWK 

       430        440        450        460 
FIAQVLDRMF LWTFLLVSII GTLGLFVPVI YKWANIIVPV HIGNTIK 

« Hide

Isoform 2 [UniParc].

Checksum: 20E24D19C4A93483
Show »

FASTA43850,294

References

« Hide 'large scale' references
[1]Groot-Kormelink P.J.
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: BALB/c.
Tissue: Brain.
[2]VanEngelenburg S., Stitzel J.A.
Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY574264 mRNA. Translation: AAS90360.1.
DQ318788 mRNA. Translation: ABC49856.1.
BC106853 mRNA. Translation: AAI06854.1.
CCDSCCDS52800.1. [Q2MKA5-2]
RefSeqNP_789814.2. NM_176844.4. [Q2MKA5-2]
XP_006510836.1. XM_006510773.1. [Q2MKA5-1]
UniGeneMm.103778.

3D structure databases

ProteinModelPortalQ2MKA5.
SMRQ2MKA5. Positions 44-446.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid225945. 2 interactions.

Chemistry

GuidetoPHARMACOLOGY466.

PTM databases

PhosphoSiteQ2MKA5.

Proteomic databases

PRIDEQ2MKA5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000093844; ENSMUSP00000091365; ENSMUSG00000035594. [Q2MKA5-2]
GeneID110835.
KEGGmmu:110835.
UCSCuc009prv.2. mouse. [Q2MKA5-2]
uc009prw.2. mouse. [Q2MKA5-1]

Organism-specific databases

CTD1138.
MGIMGI:87889. Chrna5.

Phylogenomic databases

eggNOGNOG267611.
GeneTreeENSGT00750000117712.
HOGENOMHOG000006756.
HOVERGENHBG003756.
InParanoidQ2MKA5.
KOK04807.
OMAKQEWVDV.
OrthoDBEOG72JWGV.
PhylomeDBQ2MKA5.
TreeFamTF315605.

Gene expression databases

BgeeQ2MKA5.
GenevestigatorQ2MKA5.

Family and domain databases

Gene3D1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
IPR002394. Nicotinic_acetylcholine_rcpt.
[Graphical view]
PANTHERPTHR18945. PTHR18945. 1 hit.
PfamPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 2 hits.
[Graphical view]
PRINTSPR00254. NICOTINICR.
PR00252. NRIONCHANNEL.
SUPFAMSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
TIGRFAMsTIGR00860. LIC. 1 hit.
PROSITEPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio364755.
PROQ2MKA5.
SOURCESearch...

Entry information

Entry nameACHA5_MOUSE
AccessionPrimary (citable) accession number: Q2MKA5
Secondary accession number(s): Q6PW45
Entry history
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: February 7, 2006
Last modified: July 9, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot