Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q2MKA5

- ACHA5_MOUSE

UniProt

Q2MKA5 - ACHA5_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuronal acetylcholine receptor subunit alpha-5

Gene

Chrna5

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.By similarity

GO - Molecular functioni

  1. acetylcholine-activated cation-selective channel activity Source: InterPro
  2. acetylcholine receptor activity Source: Ensembl

GO - Biological processi

  1. behavioral response to nicotine Source: Ensembl
  2. response to nicotine Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_198583. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
REACT_198585. Highly calcium permeable nicotinic acetylcholine receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal acetylcholine receptor subunit alpha-5
Gene namesi
Name:Chrna5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 9

Organism-specific databases

MGIiMGI:87889. Chrna5.

Subcellular locationi

GO - Cellular componenti

  1. acetylcholine-gated channel complex Source: MGI
  2. cell junction Source: UniProtKB-KW
  3. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 467438Neuronal acetylcholine receptor subunit alpha-5PRO_0000304938Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi155 – 1551N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi170 ↔ 184By similarity
Glycosylationi183 – 1831N-linked (GlcNAc...)Sequence Analysis
Glycosylationi229 – 2291N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi234 ↔ 235Associated with receptor activationBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ2MKA5.

PTM databases

PhosphoSiteiQ2MKA5.

Expressioni

Gene expression databases

BgeeiQ2MKA5.
GenevestigatoriQ2MKA5.

Interactioni

Subunit structurei

Neuronal AChR seems to be composed of two different type of subunits: alpha and non-alpha (beta).By similarity

Protein-protein interaction databases

BioGridi225945. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ2MKA5.
SMRiQ2MKA5. Positions 44-446.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini338 – 42992CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini451 – 46717ExtracellularSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei255 – 27521HelicalSequence AnalysisAdd
BLAST
Transmembranei284 – 30421HelicalSequence AnalysisAdd
BLAST
Transmembranei317 – 33721HelicalSequence AnalysisAdd
BLAST
Transmembranei430 – 45021HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG267611.
GeneTreeiENSGT00760000118930.
HOGENOMiHOG000006756.
HOVERGENiHBG003756.
InParanoidiQ2MKA5.
KOiK04807.
OMAiKQEWVDV.
OrthoDBiEOG72JWGV.
PhylomeDBiQ2MKA5.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
IPR002394. Nicotinic_acetylcholine_rcpt.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 2 hits.
[Graphical view]
PRINTSiPR00254. NICOTINICR.
PR00252. NRIONCHANNEL.
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
TIGRFAMsiTIGR00860. LIC. 1 hit.
PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q2MKA5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARGSRRRA LRLLLMVQLL AGRWRPAGAA RGARGGLPEL SSAAKHEDSL
60 70 80 90 100
FRDLFEDYEK WVRPVEHLSD KIKIKFGLAI SQLVDVDEKN QLMTTNVWLK
110 120 130 140 150
QEWIDVKLRW NPDDYGGIKI IRVPSDSLWI PDIVLFDNAD GRFEGASTKT
160 170 180 190 200
VVRYNGTVTW TQPANYKSSC TIDVTFFPFD LQNCSMKFGS WTYDGSQVDI
210 220 230 240 250
ILEDQDVDRT DFFDNGEWEI MSAMGSKGNR TDSCCWYPCI TYSFVIKRLP
260 270 280 290 300
LFYTLFLIIP CIGLSFLTVV VFYLPSNEGE KISLCTSVLV SLTVFLLVIE
310 320 330 340 350
EIIPSSSKVI PLIGEYLVFT MIFVTLSIMV TVFAINIHHR SSSTHNAMAP
360 370 380 390 400
WVRKIFLHKL PKLLCMRSHA DRYFTQREEA EKDGGPKSRN TLEAALDCIR
410 420 430 440 450
YITRHVVKEN DVREVVEDWK FIAQVLDRMF LWTFLLVSII GTLGLFVPVI
460
YKWANIIVPV HIGNTIK
Length:467
Mass (Da):53,448
Last modified:February 7, 2006 - v1
Checksum:i8F5BBA03D6191BA8
GO
Isoform 2 (identifier: Q2MKA5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAARGSRRRALRLLLMVQLLAGRWRPAGAARGARG → MQISNA

Show »
Length:438
Mass (Da):50,294
Checksum:i20E24D19C4A93483
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MAARG…RGARG → MQISNA in isoform 2. 2 PublicationsVSP_028132Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY574264 mRNA. Translation: AAS90360.1.
DQ318788 mRNA. Translation: ABC49856.1.
BC106853 mRNA. Translation: AAI06854.1.
CCDSiCCDS52800.1. [Q2MKA5-2]
RefSeqiNP_789814.2. NM_176844.4. [Q2MKA5-2]
XP_006510836.1. XM_006510773.1. [Q2MKA5-1]
UniGeneiMm.103778.

Genome annotation databases

EnsembliENSMUST00000093844; ENSMUSP00000091365; ENSMUSG00000035594. [Q2MKA5-2]
GeneIDi110835.
KEGGimmu:110835.
UCSCiuc009prv.2. mouse. [Q2MKA5-2]
uc009prw.2. mouse. [Q2MKA5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY574264 mRNA. Translation: AAS90360.1 .
DQ318788 mRNA. Translation: ABC49856.1 .
BC106853 mRNA. Translation: AAI06854.1 .
CCDSi CCDS52800.1. [Q2MKA5-2 ]
RefSeqi NP_789814.2. NM_176844.4. [Q2MKA5-2 ]
XP_006510836.1. XM_006510773.1. [Q2MKA5-1 ]
UniGenei Mm.103778.

3D structure databases

ProteinModelPortali Q2MKA5.
SMRi Q2MKA5. Positions 44-446.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 225945. 2 interactions.

Chemistry

GuidetoPHARMACOLOGYi 466.

PTM databases

PhosphoSitei Q2MKA5.

Proteomic databases

PRIDEi Q2MKA5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000093844 ; ENSMUSP00000091365 ; ENSMUSG00000035594 . [Q2MKA5-2 ]
GeneIDi 110835.
KEGGi mmu:110835.
UCSCi uc009prv.2. mouse. [Q2MKA5-2 ]
uc009prw.2. mouse. [Q2MKA5-1 ]

Organism-specific databases

CTDi 1138.
MGIi MGI:87889. Chrna5.

Phylogenomic databases

eggNOGi NOG267611.
GeneTreei ENSGT00760000118930.
HOGENOMi HOG000006756.
HOVERGENi HBG003756.
InParanoidi Q2MKA5.
KOi K04807.
OMAi KQEWVDV.
OrthoDBi EOG72JWGV.
PhylomeDBi Q2MKA5.
TreeFami TF315605.

Enzyme and pathway databases

Reactomei REACT_198583. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
REACT_198585. Highly calcium permeable nicotinic acetylcholine receptors.

Miscellaneous databases

NextBioi 364755.
PROi Q2MKA5.
SOURCEi Search...

Gene expression databases

Bgeei Q2MKA5.
Genevestigatori Q2MKA5.

Family and domain databases

Gene3Di 1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProi IPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
IPR002394. Nicotinic_acetylcholine_rcpt.
[Graphical view ]
PANTHERi PTHR18945. PTHR18945. 1 hit.
Pfami PF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 2 hits.
[Graphical view ]
PRINTSi PR00254. NICOTINICR.
PR00252. NRIONCHANNEL.
SUPFAMi SSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
TIGRFAMsi TIGR00860. LIC. 1 hit.
PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Groot-Kormelink P.J.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: BALB/c.
    Tissue: Brain.
  2. VanEngelenburg S., Stitzel J.A.
    Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiACHA5_MOUSE
AccessioniPrimary (citable) accession number: Q2MKA5
Secondary accession number(s): Q6PW45
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: February 7, 2006
Last modified: October 29, 2014
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3