Reviewed,
UniProtKB/Swiss-Prot Q2LAE1 (ASHH2_ARATH)
Last modified
June 16, 2009.
Version 33.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase ASHH2 EC=2.1.1.43 Alternative name(s): H3-K4-HMTase Histone H3-K36 methyltransferase 8 H3-K36-HMTase ASH1 homolog 2 Protein EARLY FLOWERING IN SHORT DAYS Protein SET DOMAIN GROUP 8 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › eurosids II › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 1759 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Histone methyltransferase. Methylates 'Lys-4' and 'Lys-36' of histone H3. H3 'Lys-4' and 'Lys-36' methylations represent specific tags for epigenetic transcriptional activation. Regulates positively FLC transcription to prevent early flowering transition. Required for flowering transition in response to vernalization. Seems also to modulate several traits including floral organ size, root size and dormancy. Promotes apical dominance. Ref.1 Ref.5 Ref.6 |
| Catalytic activity | S-adenosyl-L-methionine + histone L-lysine = S-adenosyl-L-homocysteine + histone N(6)-methyl-L-lysine. |
| Subcellular location | Nucleus Probable. Centromere Probable. Note: Associates with centromeric constitutive heterochromatin Probable. |
| Tissue specificity | Ubiquitous, with higher levels in young tissues, including shoot and root apex. Ref.1 Ref.6 |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. SET2 subfamily. Contains 1 AWS domain. Contains 1 CW-type zinc finger. Contains 1 post-SET domain. Contains 1 SET domain. |
| Sequence caution | The sequence AAC34358.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q2LAE1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q2LAE1-2) The sequence of this isoform differs from the canonical sequence as follows: 1447-1447: G → GLQMLHNIMKQYRGDFKRIPIIRKLLKVLEYLATRKILALEHIIRRP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1759 | 1759 | Histone-lysine N-methyltransferase ASHH2 | PRO_0000233371 | |||||
Regions | |||||||||
| Domain | 974 – 1024 | 51 | AWS | ||||||
| Domain | 1025 – 1147 | 123 | SET | ||||||
| Domain | 1151 – 1167 | 17 | Post-SET | ||||||
| Zinc finger | 859 – 912 | 54 | CW-type | ||||||
Natural variations | |||||||||
| Alternative sequence | 1447 | 1 | G → GLQMLHNIMKQYRGDFKRIP IIRKLLKVLEYLATRKILAL EHIIRRP in isoform 2. | VSP_018133 | |||||
Experimental info | |||||||||
| Sequence conflict | 1426 | 1 | I → T in BAD94318. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36." Zhao Z., Yu Y., Meyer D., Wu C., Shen W.-H. Nat. Cell Biol. 7:1256-1260(2005) [PubMed: 16299497] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana." Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. Davis R.W.Nature 408:816-820(2000) [PubMed: 11130712] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs." Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K. Shinozaki K.Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1299-1759 (ISOFORM 2). Strain: cv. Columbia. |
| [4] | "The Arabidopsis thaliana genome contains at least 29 active genes encoding SET domain proteins that can be assigned to four evolutionarily conserved classes." Baumbusch L.O., Thorstensen T., Krauss V., Fischer A., Naumann K., Assalkhou R., Schulz I., Reuter G., Aalen R.B. Nucleic Acids Res. 29:4319-4333(2001) [PubMed: 11691919] [Abstract] Cited for: NOMENCLATURE. |
| [5] | "The early-flowering mutant efs is involved in the autonomous promotion pathway of Arabidopsis thaliana." Soppe W.J.J., Bentsink L., Koornneef M. Development 126:4763-4770(1999) [PubMed: 10518493] [Abstract] Cited for: FUNCTION. |
| [6] | "Establishment of the vernalization-responsive, winter-annual habit in Arabidopsis requires a putative histone H3 methyl transferase." Kim S.Y., He Y., Jacob Y., Noh Y.-S., Michaels S., Amasino R. Plant Cell 17:3301-3310(2005) [PubMed: 16258034] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| DQ340869 mRNA. Translation: ABC69038.1. AC004260 Genomic DNA. Translation: AAC34358.1. Sequence problems. AK221916 mRNA. Translation: BAD94318.1. Different initiation. | |
| IPI | IPI00542920. IPI00759360. |
| PIR | T00458. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1PEG based on UniProtKB Q8X225. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q2LAE1. |
Genome annotation databases | |
| GenomeReviews | Gene locus AT1G77300 in contig CT485782_GR. |
Organism-specific databases | |
| TAIR | At1g77300. |
Enzyme and pathway databases | |
| BRENDA | 2.1.1.43. 302. |
Gene expression databases | |
| GermOnline | AT1G77300. Arabidopsis thaliana. |
Family and domain databases | |
| InterPro | IPR006560. AWS. IPR003616. Post-SET_Zn_bd. IPR001214. SET. IPR011124. Znf_CW. [Graphical view] |
| Pfam | PF00856. SET. 1 hit. PF07496. zf-CW. 1 hit. [Graphical view] |
| SMART | SM00570. AWS. 1 hit. SM00508. PostSET. 1 hit. SM00317. SET. 1 hit. [Graphical view] |
| PROSITE | PS51215. AWS. 1 hit. PS50868. POST_SET. 1 hit. PS50280. SET. 1 hit. PS51050. ZF_CW. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | ASHH2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q2LAE1 Secondary accession number(s): O80663, Q56WW4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with


