Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamine and serine-rich protein 1

Gene

QSER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamine and serine-rich protein 1
Gene namesi
Name:QSER1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:26154. QSER1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485589.

Polymorphism and mutation databases

BioMutaiQSER1.
DMDMi308153569.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17351735Glutamine and serine-rich protein 1PRO_0000288933Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei586 – 5861PhosphoserineCombined sources
Modified residuei615 – 6151PhosphoserineCombined sources
Modified residuei886 – 8861PhosphoserineCombined sources
Modified residuei949 – 9491PhosphothreonineCombined sources
Modified residuei987 – 9871PhosphoserineCombined sources
Modified residuei1211 – 12111PhosphoserineCombined sources
Modified residuei1230 – 12301PhosphoserineCombined sources
Modified residuei1231 – 12311PhosphoserineCombined sources
Modified residuei1239 – 12391PhosphoserineCombined sources
Modified residuei1341 – 13411PhosphothreonineCombined sources
Modified residuei1348 – 13481PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ2KHR3.
MaxQBiQ2KHR3.
PaxDbiQ2KHR3.
PeptideAtlasiQ2KHR3.
PRIDEiQ2KHR3.

PTM databases

iPTMnetiQ2KHR3.
PhosphoSiteiQ2KHR3.

Expressioni

Gene expression databases

BgeeiENSG00000060749.
CleanExiHS_QSER1.
ExpressionAtlasiQ2KHR3. baseline and differential.
GenevisibleiQ2KHR3. HS.

Organism-specific databases

HPAiHPA005682.

Interactioni

Protein-protein interaction databases

BioGridi122924. 14 interactions.
IntActiQ2KHR3. 10 interactions.
STRINGi9606.ENSP00000382241.

Structurei

3D structure databases

ProteinModelPortaliQ2KHR3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi120 – 527408Ser-richAdd
BLAST
Compositional biasi641 – 789149Gln-richAdd
BLAST

Phylogenomic databases

eggNOGiKOG4805. Eukaryota.
ENOG410XTD1. LUCA.
GeneTreeiENSGT00440000037417.
HOGENOMiHOG000232191.
HOVERGENiHBG089439.
InParanoidiQ2KHR3.
OMAiEGMYRER.
OrthoDBiEOG091G00EN.
PhylomeDBiQ2KHR3.
TreeFamiTF333141.

Family and domain databases

InterProiIPR025451. DUF4211.
[Graphical view]
PfamiPF13926. DUF4211. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2KHR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFLSTAESR TAQAAASGTT LLPQFRAPSW QTGMHSSAAT ELFATGPLPS
60 70 80 90 100
TGTLPPSLSA YQHPTTFSNR NFATTSPLVL QDSTFNTTSN GILSHHDPLL
110 120 130 140 150
QIKTSQGTVP TALAFERLGS SVLSNSIPPQ SSTYRSAQES APHLLQPQFS
160 170 180 190 200
LLPSALGGSQ QTPQAYSSTL FTSSTASIER ALLRECSVIK HHQRPSGTQS
210 220 230 240 250
IQAQLTGSQH SLHSYLSNSS VVNFQETTRQ SSLSCSPIGD STQVSNGGLQ
260 270 280 290 300
QKTSQVSVEL AQSYSSAIPS SGYPPSTTKI KSCSTEQPLT STKTPKPQSI
310 320 330 340 350
IPPVQTLSYS KPLHNQSSVI SGQAQIYSTA QLPSLLSVSQ SQNYGLVQPH
360 370 380 390 400
NVPSIVHSQV YRSSKVEKLP PLYKTLTFSG SSQTVTPENQ TLNYSSNQQE
410 420 430 440 450
VLSSVTNENY PAQTRDLSSV SQSQSYSSGH SQGLSPVSQT QVSYSSQSQV
460 470 480 490 500
LSVVSLSESY ASGESLTLTA PSLSYSSASR AQNLPDSSPT QNYISMHSSQ
510 520 530 540 550
NVQTQESSSP QSQKFLPAVQ SSSFASSTHC QTLQNNITSP DPKSYAERKL
560 570 580 590 600
DSDVYPSSKQ EDGFPMQELQ VLQPQASLES STQRLSDGEI NAQESTYKVS
610 620 630 640 650
KADDRYSQSV IRSNSRLEDQ VIGVALQASK KEESVVGSVT QLNQQIGQVN
660 670 680 690 700
NAATLDLKNS TNLIQTPQIR LNTKDLKQQH PLILKVHESK VQEQHDQIIN
710 720 730 740 750
ASSQIQIPNH ALGHGHQASL PNTQVLLDSA CDLQILQQSI LQAGLGQVKA
760 770 780 790 800
SLQAQRVQSP QQIVHPFLQM EGHVIQSNGD HSQQQLHPQN SEVMKMDLSE
810 820 830 840 850
SSKPLQQHLT TKGHFSETNQ HDSKNQFVSL GSMCFPEAVL LSDERNILSN
860 870 880 890 900
VDDILAATAA ACGVTPTDFS KSTSNETMQA VEDGDSKSHF QQSLDVRHVT
910 920 930 940 950
SDFNSMTATV GKPQNINDTS LNGNQVTVNL SPVPALQSKM TLDQQHIETP
960 970 980 990 1000
GQNIPTKVTS AVVGPSHEVQ EQSSGPFKKQ SATNLESEED SEAPVDSTLN
1010 1020 1030 1040 1050
NNRNQEFVSS SRSISGENAT SESEFTLGGD DSGVSMNPAR SALALLAMAQ
1060 1070 1080 1090 1100
SGDAVSVKIE EENQDLMHFN LQKKRAKGKG QVKEEDNSNQ KQLKRPAQGK
1110 1120 1130 1140 1150
RQNPRGTDIY LPYTPPSSES CHDGYQHQEK MRQKIKEVEE KQPEVKTGFI
1160 1170 1180 1190 1200
ASFLDFLKSG PKQQFSTLAV RMPNRTRRPG TQMVRTFCPP PLPKPSSTTP
1210 1220 1230 1240 1250
TPLVSETGGN SPSDKVDNEL KNLEHLSSFS SDEDDPGYSQ DAYKSVSTPL
1260 1270 1280 1290 1300
TTLDATSDKK KKTEALQVAT TSPTANTTGT ATTSSTTVGA VKQEPLHSTS
1310 1320 1330 1340 1350
YAVNILENIS SSESSKPIEL DGLPSDQFAK GQDTVAIEGF TDEEDTESGG
1360 1370 1380 1390 1400
EGQYRERDEF VVKIEDIETF KEALKTGKEP PAIWKVQKAL LQKFVPEIRD
1410 1420 1430 1440 1450
GQREFAATNS YLGYFGDAKS KYKRIYVKFI ENANKKEYVR VCSKKPRNKP
1460 1470 1480 1490 1500
SQTIRTVQAK PSSSSKTSDP LASKTTTTKA PSVKPKVKQP KVKAEPPPKK
1510 1520 1530 1540 1550
RKKWKEEFSS SQSDSSPEIH TSSSDDEEFE PPAPFVTRFL NTRAMKETFK
1560 1570 1580 1590 1600
SYMELLVSIA LDPDTMQALE KSNDELLLPH MKKIDGMLND NRKRLLLNLH
1610 1620 1630 1640 1650
LDQSFKNALE SFPELTIITR DSKAKSGGTA ISKIKMNGKA YNKKTLRTSK
1660 1670 1680 1690 1700
TTTKSAQEFA VDPEKIQLYS LYHSLHHYKY HVYLICKDEI SSVQKKNEDL
1710 1720 1730
GQEEIVQLCM KNVKWVEDLF EKFGELLNHV QQKCS
Length:1,735
Mass (Da):189,972
Last modified:October 5, 2010 - v3
Checksum:i9FC28818DBB42A92
GO
Isoform 2 (identifier: Q2KHR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     243-481: Missing.
     1730-1735: VQQKCS → TGMLGEMQSVSVSSTRRSEQQNILEAGKSKIKVPVSGDC

Note: No experimental confirmation available.
Show »
Length:1,529
Mass (Da):168,003
Checksum:i811508C5F1B2FC4F
GO

Sequence cautioni

The sequence AAI12936 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC86397 differs from that shown. Reason: Erroneous termination at position 1555. Translated as Leu.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti291 – 2911S → P in AK125391 (PubMed:14702039).Curated
Sequence conflicti486 – 4861D → N in AK125391 (PubMed:14702039).Curated
Sequence conflicti1075 – 10751R → G in AK125391 (PubMed:14702039).Curated
Sequence conflicti1247 – 12471S → P in AK125391 (PubMed:14702039).Curated
Sequence conflicti1258 – 12581D → E in AK125391 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti385 – 3851V → I.2 Publications
Corresponds to variant rs1022586 [ dbSNP | Ensembl ].
VAR_056975
Natural varianti644 – 6441Q → R.
Corresponds to variant rs2297781 [ dbSNP | Ensembl ].
VAR_032535
Natural varianti1018 – 10181N → S.Combined sources2 Publications
Corresponds to variant rs7940077 [ dbSNP | Ensembl ].
VAR_032536
Natural varianti1304 – 13041N → D.
Corresponds to variant rs16923676 [ dbSNP | Ensembl ].
VAR_032537

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei243 – 481239Missing in isoform 2. 1 PublicationVSP_039815Add
BLAST
Alternative sequencei1730 – 17356VQQKCS → TGMLGEMQSVSVSSTRRSEQ QNILEAGKSKIKVPVSGDC in isoform 2. 1 PublicationVSP_039816

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125391 mRNA. No translation available.
AK126023 mRNA. Translation: BAC86397.1. Sequence problems.
AC107939 Genomic DNA. No translation available.
BC112935 mRNA. Translation: AAI12936.1. Sequence problems.
CCDSiCCDS41631.1. [Q2KHR3-1]
RefSeqiNP_001070254.1. NM_001076786.2. [Q2KHR3-1]
UniGeneiHs.369368.

Genome annotation databases

EnsembliENST00000399302; ENSP00000382241; ENSG00000060749. [Q2KHR3-1]
ENST00000527788; ENSP00000432766; ENSG00000060749. [Q2KHR3-2]
GeneIDi79832.
KEGGihsa:79832.
UCSCiuc001mty.4. human. [Q2KHR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125391 mRNA. No translation available.
AK126023 mRNA. Translation: BAC86397.1. Sequence problems.
AC107939 Genomic DNA. No translation available.
BC112935 mRNA. Translation: AAI12936.1. Sequence problems.
CCDSiCCDS41631.1. [Q2KHR3-1]
RefSeqiNP_001070254.1. NM_001076786.2. [Q2KHR3-1]
UniGeneiHs.369368.

3D structure databases

ProteinModelPortaliQ2KHR3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122924. 14 interactions.
IntActiQ2KHR3. 10 interactions.
STRINGi9606.ENSP00000382241.

PTM databases

iPTMnetiQ2KHR3.
PhosphoSiteiQ2KHR3.

Polymorphism and mutation databases

BioMutaiQSER1.
DMDMi308153569.

Proteomic databases

EPDiQ2KHR3.
MaxQBiQ2KHR3.
PaxDbiQ2KHR3.
PeptideAtlasiQ2KHR3.
PRIDEiQ2KHR3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399302; ENSP00000382241; ENSG00000060749. [Q2KHR3-1]
ENST00000527788; ENSP00000432766; ENSG00000060749. [Q2KHR3-2]
GeneIDi79832.
KEGGihsa:79832.
UCSCiuc001mty.4. human. [Q2KHR3-1]

Organism-specific databases

CTDi79832.
GeneCardsiQSER1.
H-InvDBHIX0009534.
HIX0171325.
HGNCiHGNC:26154. QSER1.
HPAiHPA005682.
neXtProtiNX_Q2KHR3.
PharmGKBiPA143485589.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4805. Eukaryota.
ENOG410XTD1. LUCA.
GeneTreeiENSGT00440000037417.
HOGENOMiHOG000232191.
HOVERGENiHBG089439.
InParanoidiQ2KHR3.
OMAiEGMYRER.
OrthoDBiEOG091G00EN.
PhylomeDBiQ2KHR3.
TreeFamiTF333141.

Miscellaneous databases

ChiTaRSiQSER1. human.
GenomeRNAii79832.
PROiQ2KHR3.

Gene expression databases

BgeeiENSG00000060749.
CleanExiHS_QSER1.
ExpressionAtlasiQ2KHR3. baseline and differential.
GenevisibleiQ2KHR3. HS.

Family and domain databases

InterProiIPR025451. DUF4211.
[Graphical view]
PfamiPF13926. DUF4211. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiQSER1_HUMAN
AccessioniPrimary (citable) accession number: Q2KHR3
Secondary accession number(s): Q6ZU30, Q6ZUR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 5, 2010
Last modified: September 7, 2016
This is version 84 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.