Q2KHR3 (QSER1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 48.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamine and serine-rich protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1735 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.4 Ref.5 Ref.6 Ref.7 Ref.8 Ref.9 |
| Sequence caution | The sequence AAI12936.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence BAC86397.1 differs from that shown. Reason: Erroneous termination at position 1555. Translated as Leu. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q2KHR3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q2KHR3-2) The sequence of this isoform differs from the canonical sequence as follows: 243-481: Missing. 1730-1735: VQQKCS → TGMLGEMQSVSVSSTRRSEQQNILEAGKSKIKVPVSGDC | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1735 | 1735 | Glutamine and serine-rich protein 1 | PRO_0000288933 | |||||
Regions | |||||||||
| Compositional bias | 120 – 527 | 408 | Ser-rich | ||||||
| Compositional bias | 641 – 789 | 149 | Gln-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 606 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 613 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 931 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 949 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 1211 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 1228 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1230 | 1 | Phosphoserine Ref.7 Ref.8 | ||||||
| Modified residue | 1231 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 | ||||||
| Modified residue | 1239 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1341 | 1 | Phosphothreonine Ref.4 Ref.7 Ref.8 Ref.9 | ||||||
| Modified residue | 1346 | 1 | Phosphothreonine Ref.4 Ref.8 | ||||||
| Modified residue | 1348 | 1 | Phosphoserine Ref.7 Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 243 – 481 | 239 | Missing in isoform 2. | VSP_039815 | |||||
| Alternative sequence | 1730 – 1735 | 6 | VQQKCS → TGMLGEMQSVSVSSTRRSEQ QNILEAGKSKIKVPVSGDC in isoform 2. | VSP_039816 | |||||
| Natural variant | 385 | 1 | V → I. Ref.1 Ref.3 Corresponds to variant rs1022586 [ dbSNP | Ensembl ]. | VAR_056975 | |||||
| Natural variant | 644 | 1 | Q → R. Corresponds to variant rs2297781 [ dbSNP | Ensembl ]. | VAR_032535 | |||||
| Natural variant | 1018 | 1 | N → S. Ref.1 Ref.3 Corresponds to variant rs7940077 [ dbSNP | Ensembl ]. | VAR_032536 | |||||
| Natural variant | 1304 | 1 | N → D. Corresponds to variant rs16923676 [ dbSNP | Ensembl ]. | VAR_032537 | |||||
Experimental info | |||||||||
| Sequence conflict | 291 | 1 | S → P in AK125391. Ref.1 | ||||||
| Sequence conflict | 486 | 1 | D → N in AK125391. Ref.1 | ||||||
| Sequence conflict | 1075 | 1 | R → G in AK125391. Ref.1 | ||||||
| Sequence conflict | 1247 | 1 | S → P in AK125391. Ref.1 | ||||||
| Sequence conflict | 1258 | 1 | D → E in AK125391. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 82-1258 (ISOFORM 1), VARIANTS ILE-385 AND SER-1018. Tissue: Brain and Testis. |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1696 (ISOFORM 1), VARIANTS ILE-385 AND SER-1018. Tissue: Uterus. |
| [4] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1341 AND THR-1346, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-606 AND SER-613, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1228; SER-1231 AND SER-1239, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-949; SER-1230; SER-1231; THR-1341 AND SER-1348, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-931; SER-1211; SER-1230; SER-1231; THR-1341; THR-1346 AND SER-1348, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1341, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK125391 mRNA. No translation available. AK126023 mRNA. Translation: BAC86397.1. Sequence problems. AC107939 Genomic DNA. No translation available. BC112935 mRNA. Translation: AAI12936.1. Sequence problems. |
| IPI | IPI00418991. IPI00847870. |
| RefSeq | NP_001070254.1. NM_001076786.1. |
| UniGene | Hs.369368. |
3D structure databases | |
| ProteinModelPortal | Q2KHR3. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q2KHR3. |
Polymorphism databases | |
| DMDM | 308153569. |
Proteomic databases | |
| PeptideAtlas | Q2KHR3. |
| PRIDE | Q2KHR3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000399302; ENSP00000382241; ENSG00000060749. |
| GeneID | 79832. |
| KEGG | hsa:79832. |
| UCSC | uc001mty.1. human. uc001mtz.1. human. |
Organism-specific databases | |
| CTD | 79832. |
| GeneCards | GC11P032905. |
| H-InvDB | HIX0009534. |
| HGNC | HGNC:26154. QSER1. |
| HPA | HPA005682. |
| neXtProt | NX_Q2KHR3. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG12982. |
| GeneTree | ENSGT00440000037417. |
| HOGENOM | HBG444812. |
| HOVERGEN | HBG089439. |
| InParanoid | Q2KHR3. |
| OMA | QIYSTAQ. |
| OrthoDB | EOG4NGGM0. |
Gene expression databases | |
| ArrayExpress | Q2KHR3. |
| Bgee | Q2KHR3. |
| CleanEx | HS_QSER1. |
| Genevestigator | Q2KHR3. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 69477. |
Entry information
| Entry name | QSER1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q2KHR3 Secondary accession number(s): Q6ZU30, Q6ZUR5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with