Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q29536 (KPYR_CANFA) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pyruvate kinase PKLR

EC=2.7.1.40
Alternative name(s):
Pyruvate kinase isozymes L/R
Gene names
Name:PKLR
OrganismCanis familiaris (Dog) (Canis lupus familiaris) [Reference proteome]
Taxonomic identifier9615 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCarnivoraCaniformiaCanidaeCanis

Protein attributes

Sequence length574 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Plays a key role in glycolysis By similarity.

Catalytic activity

ATP + pyruvate = ADP + phosphoenolpyruvate.

Cofactor

Magnesium By similarity.

Potassium By similarity.

Enzyme regulation

Allosterically activated by fructose 1,6-bisphosphate By similarity.

Pathway

Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.

Subunit structure

Homotetramer By similarity.

Involvement in disease

Defects in PKLR are a cause of inherited hemolytic anemia, an autosomal recessive disease of the Basenji dog that closely resembles human pyruvate kinase deficiency.

Miscellaneous

There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.

Sequence similarities

Belongs to the pyruvate kinase family.

Sequence caution

The sequence DN338485 differs from that shown. Reason: Derived from EST data.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform R-type (identifier: Q29536-1)

Also known as: PKR;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform L-type (identifier: Q29536-2)

Also known as: PKL;

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSSQENIQPQELWSRISKSQRDLAKSILIGAPG → ME

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 574574Pyruvate kinase PKLR
PRO_0000112093

Regions

Region475 – 4806Allosteric activator binding By similarity
Region559 – 5646Allosteric activator binding By similarity

Sites

Metal binding1181Potassium By similarity
Metal binding1201Potassium By similarity
Metal binding1561Potassium By similarity
Metal binding1571Potassium; via carbonyl oxygen By similarity
Metal binding3151Magnesium By similarity
Metal binding3391Magnesium By similarity
Binding site1161Substrate By similarity
Binding site3381Substrate; via amide nitrogen By similarity
Binding site3391Substrate; via amide nitrogen By similarity
Binding site3711Substrate By similarity
Binding site5251Allosteric activator By similarity
Binding site5321Allosteric activator By similarity
Site3131Transition state stabilizer By similarity

Natural variations

Alternative sequence1 – 3333MSSQE…IGAPG → ME in isoform L-type.
VSP_042444

Experimental info

Sequence conflict4231A → R in AAB31627. Ref.2
Sequence conflict458 – 4592GA → AT in AAB31627. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform R-type (PKR) [UniParc].

Last modified March 21, 2012. Version 2.
Checksum: F18E28450B1C7F30

FASTA57462,048
        10         20         30         40         50         60 
MSSQENIQPQ ELWSRISKSQ RDLAKSILIG APGGPAGYLR RASVAQLTLE LGTAFFQQQQ 

        70         80         90        100        110        120 
LSAAMADTFL EHLCLLDIDS EPVAARSTSI IATIGPASHS VERLKEMIKA GMNIARLNFS 

       130        140        150        160        170        180 
HGSHEYHAQS IANIREAVES FATSPLGYRP VAIALDTKGP EIRTGVLKGG PETEVELVKG 

       190        200        210        220        230        240 
SWVLVTVDPA FRTLGDAHTV WVDYPNIVKV VPVGGRIFID DGLISLQVKK IDRKGLETQV 

       250        260        270        280        290        300 
ENGGLLGSRK GVNLPGAEVD LPGLSEQDAQ DLRFGVEHNV DIVFASFVRK ASDVAAIRAA 

       310        320        330        340        350        360 
LGPEGRTIKI ISKIENHEGV KKFDEILEVS DGIMVARGDL GIEIPAEKVF LAQKMMIGRC 

       370        380        390        400        410        420 
NLAGKPVVCA TQMLESMITK PRPTRAETSD VANAVLDGAD CIMLSGETAK GKFPVEAVKM 

       430        440        450        460        470        480 
QHAIAREAEA AVYHRQLFEE LRRAAPLSRD PTEVTAIGAV EAAFKCCAAA IIVLTKTGRS 

       490        500        510        520        530        540 
AQLLSRYRPR AAVIAVTRSA QAARQAHLCR GVFPLLYSEP PEAIWADDVD RRVQFGIESG 

       550        560        570 
KLRGFLRVGD LVIVVTGWRP GSGYTNIMRV LSIS 

« Hide

Isoform L-type (PKL) [UniParc].

Checksum: C4976F7282F91798
Show »

FASTA54358,657

References

« Hide 'large scale' references
[1]"Genome sequence, comparative analysis and haplotype structure of the domestic dog."
Lindblad-Toh K., Wade C.M., Mikkelsen T.S., Karlsson E.K., Jaffe D.B., Kamal M., Clamp M., Chang J.L., Kulbokas E.J. III, Zody M.C., Mauceli E., Xie X., Breen M., Wayne R.K., Ostrander E.A., Ponting C.P., Galibert F., Smith D.R. expand/collapse author list , deJong P.J., Kirkness E.F., Alvarez P., Biagi T., Brockman W., Butler J., Chin C.-W., Cook A., Cuff J., Daly M.J., DeCaprio D., Gnerre S., Grabherr M., Kellis M., Kleber M., Bardeleben C., Goodstadt L., Heger A., Hitte C., Kim L., Koepfli K.-P., Parker H.G., Pollinger J.P., Searle S.M.J., Sutter N.B., Thomas R., Webber C., Baldwin J., Abebe A., Abouelleil A., Aftuck L., Ait-Zahra M., Aldredge T., Allen N., An P., Anderson S., Antoine C., Arachchi H., Aslam A., Ayotte L., Bachantsang P., Barry A., Bayul T., Benamara M., Berlin A., Bessette D., Blitshteyn B., Bloom T., Blye J., Boguslavskiy L., Bonnet C., Boukhgalter B., Brown A., Cahill P., Calixte N., Camarata J., Cheshatsang Y., Chu J., Citroen M., Collymore A., Cooke P., Dawoe T., Daza R., Decktor K., DeGray S., Dhargay N., Dooley K., Dooley K., Dorje P., Dorjee K., Dorris L., Duffey N., Dupes A., Egbiremolen O., Elong R., Falk J., Farina A., Faro S., Ferguson D., Ferreira P., Fisher S., FitzGerald M., Foley K., Foley C., Franke A., Friedrich D., Gage D., Garber M., Gearin G., Giannoukos G., Goode T., Goyette A., Graham J., Grandbois E., Gyaltsen K., Hafez N., Hagopian D., Hagos B., Hall J., Healy C., Hegarty R., Honan T., Horn A., Houde N., Hughes L., Hunnicutt L., Husby M., Jester B., Jones C., Kamat A., Kanga B., Kells C., Khazanovich D., Kieu A.C., Kisner P., Kumar M., Lance K., Landers T., Lara M., Lee W., Leger J.-P., Lennon N., Leuper L., LeVine S., Liu J., Liu X., Lokyitsang Y., Lokyitsang T., Lui A., Macdonald J., Major J., Marabella R., Maru K., Matthews C., McDonough S., Mehta T., Meldrim J., Melnikov A., Meneus L., Mihalev A., Mihova T., Miller K., Mittelman R., Mlenga V., Mulrain L., Munson G., Navidi A., Naylor J., Nguyen T., Nguyen N., Nguyen C., Nguyen T., Nicol R., Norbu N., Norbu C., Novod N., Nyima T., Olandt P., O'Neill B., O'Neill K., Osman S., Oyono L., Patti C., Perrin D., Phunkhang P., Pierre F., Priest M., Rachupka A., Raghuraman S., Rameau R., Ray V., Raymond C., Rege F., Rise C., Rogers J., Rogov P., Sahalie J., Settipalli S., Sharpe T., Shea T., Sheehan M., Sherpa N., Shi J., Shih D., Sloan J., Smith C., Sparrow T., Stalker J., Stange-Thomann N., Stavropoulos S., Stone C., Stone S., Sykes S., Tchuinga P., Tenzing P., Tesfaye S., Thoulutsang D., Thoulutsang Y., Topham K., Topping I., Tsamla T., Vassiliev H., Venkataraman V., Vo A., Wangchuk T., Wangdi T., Weiand M., Wilkinson J., Wilson A., Yadav S., Yang S., Yang X., Young G., Yu Q., Zainoun J., Zembek L., Zimmer A., Lander E.S.
Nature 438:803-819(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Boxer.
[2]"The molecular basis of canine pyruvate kinase deficiency."
Whitney K.M., Goodman S.A., Bailey E.M., Lothrop C.D. Jr.
Exp. Hematol. 22:866-874(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 56-574.
Tissue: Reticulocyte.
[3]Staten N.R.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-134 (ISOFORM L-TYPE).
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AAEX03005338 Genomic DNA. No translation available.
AH004600 mRNA. Translation: AAB31627.2.
DN338485 mRNA. No translation available.
RefSeqNP_001242947.1. NM_001256018.1.
NP_001243191.1. NM_001256262.1. [Q29536-1]
UniGeneCfa.8012.

3D structure databases

ProteinModelPortalQ29536.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9615.ENSCAFP00000030741.

Proteomic databases

PaxDbQ29536.
PRIDEQ29536.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID490425.
KEGGcfa:490425.

Organism-specific databases

CTD5313.

Phylogenomic databases

eggNOGCOG0469.
HOGENOMHOG000021559.
HOVERGENHBG000941.
InParanoidQ29536.
KOK12406.

Enzyme and pathway databases

UniPathwayUPA00109; UER00188.

Family and domain databases

Gene3D2.40.33.10. 1 hit.
3.20.20.60. 2 hits.
3.40.1380.20. 1 hit.
InterProIPR001697. Pyr_Knase.
IPR015813. Pyrv/PenolPyrv_Kinase-like_dom.
IPR011037. Pyrv_Knase-like_insert_dom.
IPR015794. Pyrv_Knase_a/b.
IPR018209. Pyrv_Knase_AS.
IPR015793. Pyrv_Knase_brl.
IPR015795. Pyrv_Knase_C.
IPR015806. Pyrv_Knase_insert_dom.
[Graphical view]
PANTHERPTHR11817. PTHR11817. 1 hit.
PfamPF00224. PK. 1 hit.
PF02887. PK_C. 1 hit.
[Graphical view]
PRINTSPR01050. PYRUVTKNASE.
SUPFAMSSF50800. SSF50800. 1 hit.
SSF51621. SSF51621. 2 hits.
SSF52935. SSF52935. 1 hit.
TIGRFAMsTIGR01064. pyruv_kin. 1 hit.
PROSITEPS00110. PYRUVATE_KINASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameKPYR_CANFA
AccessionPrimary (citable) accession number: Q29536
Secondary accession number(s): F1P923, F1PXP8, F1PY57
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 21, 2012
Last modified: June 11, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways