Q29536 (KPYR_CANFA) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pyruvate kinase isozymes R/L EC=2.7.1.40 | ||
| Gene names |
| ||
| Organism | Canis familiaris (Dog) (Canis lupus familiaris) [Reference proteome] | ||
| Taxonomic identifier | 9615 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Carnivora › Caniformia › Canidae › Canis › ![]() |
Protein attributes
| Sequence length | 574 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Plays a key role in glycolysis By similarity. |
| Catalytic activity | ATP + pyruvate = ADP + phosphoenolpyruvate. |
| Cofactor | Magnesium By similarity. Potassium By similarity. |
| Enzyme regulation | Allosterically activated by fructose 1,6-bisphosphate By similarity. |
| Pathway | Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5. |
| Subunit structure | Homotetramer By similarity. |
| Involvement in disease | Defects in PKLR are a cause of inherited hemolytic anemia, an autosomal recessive disease of the Basenji dog that closely resembles human pyruvate kinase deficiency. |
| Miscellaneous | There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues. |
| Sequence similarities | Belongs to the pyruvate kinase family. |
| Sequence caution | The sequence DN338485 differs from that shown. Reason: Derived from EST data. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Glycolysis |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding Potassium Pyruvate |
| Molecular function | Kinase Transferase |
| Technical term | Allosteric enzyme Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | glycolysis Inferred from electronic annotation. Source: UniProtKB-UniPathway response to other organismInferred from electronic annotation. Source: Compara |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW magnesium ion bindingInferred from electronic annotation. Source: InterPro potassium ion bindingInferred from electronic annotation. Source: InterPro pyruvate kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform R-type (identifier: Q29536-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform L-type (identifier: Q29536-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSSQENIQPQELWSRISKSQRDLAKSILIGAPG → ME |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 574 | 574 | Pyruvate kinase isozymes R/L | PRO_0000112093 | |||||
Regions | |||||||||
| Region | 475 – 480 | 6 | Allosteric activator binding By similarity | ||||||
| Region | 559 – 564 | 6 | Allosteric activator binding By similarity | ||||||
Sites | |||||||||
| Metal binding | 118 | 1 | Potassium By similarity | ||||||
| Metal binding | 120 | 1 | Potassium By similarity | ||||||
| Metal binding | 156 | 1 | Potassium By similarity | ||||||
| Metal binding | 157 | 1 | Potassium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 315 | 1 | Magnesium By similarity | ||||||
| Metal binding | 339 | 1 | Magnesium By similarity | ||||||
| Binding site | 116 | 1 | Substrate By similarity | ||||||
| Binding site | 338 | 1 | Substrate; via amide nitrogen By similarity | ||||||
| Binding site | 339 | 1 | Substrate; via amide nitrogen By similarity | ||||||
| Binding site | 371 | 1 | Substrate By similarity | ||||||
| Binding site | 525 | 1 | Allosteric activator By similarity | ||||||
| Binding site | 532 | 1 | Allosteric activator By similarity | ||||||
| Site | 313 | 1 | Transition state stabilizer By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MSSQE…IGAPG → ME in isoform L-type. | VSP_042444 | |||||
Experimental info | |||||||||
| Sequence conflict | 423 | 1 | A → R in AAB31627. Ref.2 | ||||||
| Sequence conflict | 458 – 459 | 2 | GA → AT in AAB31627. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genome sequence, comparative analysis and haplotype structure of the domestic dog." Lindblad-Toh K., Wade C.M., Mikkelsen T.S., Karlsson E.K., Jaffe D.B., Kamal M., Clamp M., Chang J.L., Kulbokas E.J. III, Zody M.C., Mauceli E., Xie X., Breen M., Wayne R.K., Ostrander E.A., Ponting C.P., Galibert F., Smith D.R. Lander E.S.Nature 438:803-819(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Boxer. |
| [2] | "The molecular basis of canine pyruvate kinase deficiency." Whitney K.M., Goodman S.A., Bailey E.M., Lothrop C.D. Jr. Exp. Hematol. 22:866-874(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 56-574. Tissue: Reticulocyte. |
| [3] | Staten N.R. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-134 (ISOFORM L-TYPE). Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AAEX03005338 Genomic DNA. No translation available. AH004600 mRNA. Translation: AAB31627.2. DN338485 mRNA. No translation available. |
| RefSeq | NP_001242947.1. NM_001256018.1. NP_001243191.1. NM_001256262.1. |
3D structure databases | |
| ProteinModelPortal | Q29536. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9615.ENSCAFP00000030741. |
Proteomic databases | |
| PaxDb | Q29536. |
| PRIDE | Q29536. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 490425. |
| KEGG | cfa:490425. |
Organism-specific databases | |
| CTD | 5313. |
Phylogenomic databases | |
| eggNOG | COG0469. |
| HOGENOM | HOG000021559. |
| HOVERGEN | HBG000941. |
| InParanoid | Q29536. |
| KO | K12406. |
| OrthoDB | EOG40GCQJ. |
Enzyme and pathway databases | |
| UniPathway | UPA00109; UER00188. |
Family and domain databases | |
| Gene3D | 2.40.33.10. 1 hit. 3.20.20.60. 2 hits. 3.40.1380.20. 1 hit. |
| InterPro | IPR001697. Pyr_Knase. IPR015813. Pyrv/PenolPyrv_Kinase. IPR011037. Pyrv_Knase-like_insert_dom. IPR015794. Pyrv_Knase_a/b. IPR018209. Pyrv_Knase_AS. IPR015793. Pyrv_Knase_brl. IPR015795. Pyrv_Knase_C. IPR015806. Pyrv_Knase_insert_dom. [Graphical view] |
| PANTHER | PTHR11817. PTHR11817. 1 hit. |
| Pfam | PF00224. PK. 1 hit. PF02887. PK_C. 1 hit. [Graphical view] |
| PRINTS | PR01050. PYRUVTKNASE. |
| SUPFAM | SSF50800. PK_B_barrel_like. 1 hit. SSF52935. Pyruvate_kinase. 1 hit. SSF51621. Pyrv/PenolPyrv_Kinase_cat. 1 hit. |
| TIGRFAMs | TIGR01064. pyruv_kin. 1 hit. |
| PROSITE | PS00110. PYRUVATE_KINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | KPYR_CANFA | ||||||||
| Accession | Primary (citable) accession number: Q29536 Secondary accession number(s): F1P923, F1PXP8, F1PY57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
