Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A13

Gene

ANXA13

Organism
Canis lupus familiaris (Dog) (Canis familiaris)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in vesicular traffic to the apical plasma membrane (isoform B).

GO - Molecular functioni

GO - Biological processi

  • negative regulation of Golgi to plasma membrane protein transport Source: UniProtKB
  • positive regulation of Golgi to plasma membrane protein transport Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calcium, Calcium/phospholipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A13
Alternative name(s):
Annexin XIII
Annexin-13
Intestine-specific annexin
Short name:
ISA
Gene namesi
Name:ANXA13
Synonyms:ANX13
OrganismiCanis lupus familiaris (Dog) (Canis familiaris)
Taxonomic identifieri9615 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCarnivoraCaniformiaCanidaeCanis
Proteomesi
  • UP000002254 Componenti: Chromosome 13

Subcellular locationi

Isoform B :

GO - Cellular componenti

  • apical plasma membrane Source: UniProtKB
  • basolateral plasma membrane Source: UniProtKB
  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB-SubCell
  • exocytic vesicle Source: UniProtKB
  • extracellular exosome Source: Ensembl
  • extracellular space Source: Ensembl
  • membrane raft Source: UniProtKB
  • nucleoplasm Source: Ensembl
  • plasma membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemoved
Chaini2 – 316315Annexin A13PRO_0000067513Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineBy similarity

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ29471.

Expressioni

Tissue specificityi

Epithelia (isoform A); intestine and kidney (isoform B).

Interactioni

Protein-protein interaction databases

BioGridi139851. 1 interaction.
STRINGi9615.ENSCAFP00000001437.

Structurei

3D structure databases

ProteinModelPortaliQ29471.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 8361Annexin 1Add
BLAST
Repeati95 – 15561Annexin 2Add
BLAST
Repeati179 – 23961Annexin 3Add
BLAST
Repeati254 – 31461Annexin 4Add
BLAST

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.

Sequence similaritiesi

Belongs to the annexin family.Curated
Contains 4 annexin repeats.Curated

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiQ29471.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG091G0H6H.
TreeFamiTF105452.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q29471-1) [UniParc]FASTAAdd to basket
Also known as: Anx13A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNRHAKAKS HHGFDVDHDA KKLNKACKGM GTDEAAIIEI LSSRTSDERQ
60 70 80 90 100
QIKQKYKATY GKDLEEVFKS DLSGNFEKTA LALLDRPSEY DARQLQKAMK
110 120 130 140 150
GLGTDEAVLI EILCTRTNKE IMAIKEAYQR LFDRSLESDV KADTSGNLKA
160 170 180 190 200
ILVSLLQANR DEGDDVDKDL AGQDAKDLYD AGDGRWGTDE LAFNEVLAKR
210 220 230 240 250
SHKQLRATFQ AYQILIDKDI EEAIEAETSG DLQKAYLTLV RCARDQEGYF
260 270 280 290 300
ADRLYKSMKG TGTDEETLIH IIVTRAEVDL QGIKAKFQEK YQKSLSDMVR
310
SDTSGDFQKL LVALLH
Length:316
Mass (Da):35,479
Last modified:January 23, 2007 - v2
Checksum:iFD0B34AE0B6C8441
GO
Isoform B (identifier: Q29471-2) [UniParc]FASTAAdd to basket
Also known as: Anx13B

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: H → HSQSYSLSEGSQQLPKGDIQPSAAVQPLSHPSGSGEPEAQQP

Show »
Length:357
Mass (Da):39,666
Checksum:i6096AE08D2655EDA
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei5 – 51H → HSQSYSLSEGSQQLPKGDIQ PSAAVQPLSHPSGSGEPEAQ QP in isoform B. 1 PublicationVSP_000290

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X80208 mRNA. Translation: CAA56506.1.
X80209 mRNA. Translation: CAA56507.1.
PIRiA57076.
B57076.
RefSeqiNP_001003255.1. NM_001003255.1. [Q29471-2]
XP_005627863.1. XM_005627806.1. [Q29471-1]
UniGeneiCfa.3796.

Genome annotation databases

EnsembliENSCAFT00000001562; ENSCAFP00000001437; ENSCAFG00000001015. [Q29471-2]
GeneIDi403935.
KEGGicfa:403935.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X80208 mRNA. Translation: CAA56506.1.
X80209 mRNA. Translation: CAA56507.1.
PIRiA57076.
B57076.
RefSeqiNP_001003255.1. NM_001003255.1. [Q29471-2]
XP_005627863.1. XM_005627806.1. [Q29471-1]
UniGeneiCfa.3796.

3D structure databases

ProteinModelPortaliQ29471.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi139851. 1 interaction.
STRINGi9615.ENSCAFP00000001437.

Proteomic databases

PaxDbiQ29471.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSCAFT00000001562; ENSCAFP00000001437; ENSCAFG00000001015. [Q29471-2]
GeneIDi403935.
KEGGicfa:403935.

Organism-specific databases

CTDi312.

Phylogenomic databases

eggNOGiKOG0819. Eukaryota.
ENOG410XPUN. LUCA.
GeneTreeiENSGT00760000118972.
HOGENOMiHOG000158803.
HOVERGENiHBG061815.
InParanoidiQ29471.
KOiK17099.
OMAiLVSCAKD.
OrthoDBiEOG091G0H6H.
TreeFamiTF105452.

Family and domain databases

Gene3Di1.10.220.10. 4 hits.
InterProiIPR001464. Annexin.
IPR018502. Annexin_repeat.
IPR018252. Annexin_repeat_CS.
IPR009166. AnnexinXIII.
[Graphical view]
PfamiPF00191. Annexin. 4 hits.
[Graphical view]
PRINTSiPR00196. ANNEXIN.
PR01811. ANNEXINXIII.
SMARTiSM00335. ANX. 4 hits.
[Graphical view]
PROSITEiPS00223. ANNEXIN. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANX13_CANLF
AccessioniPrimary (citable) accession number: Q29471
Secondary accession number(s): Q29472
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.