Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Annexin A13

Gene

ANXA13

Organism
Canis lupus familiaris (Dog) (Canis familiaris)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in vesicular traffic to the apical plasma membrane (isoform B).

GO - Molecular functioni

GO - Biological processi

  • negative regulation of Golgi to plasma membrane protein transport Source: UniProtKB
  • positive regulation of Golgi to plasma membrane protein transport Source: UniProtKB

Keywordsi

LigandCalcium, Calcium/phospholipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Annexin A13
Alternative name(s):
Annexin XIII
Annexin-13
Intestine-specific annexin
Short name:
ISA
Gene namesi
Name:ANXA13
Synonyms:ANX13
OrganismiCanis lupus familiaris (Dog) (Canis familiaris)
Taxonomic identifieri9615 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCarnivoraCaniformiaCanidaeCanis
Proteomesi
  • UP000002254 Componenti: Chromosome 13

Organism-specific databases

VGNCiVGNC:37939 ANXA13

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00000675132 – 316Annexin A13Add BLAST315

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ29471

Expressioni

Tissue specificityi

Epithelia (isoform A); intestine and kidney (isoform B).

Gene expression databases

BgeeiENSCAFG00000001015

Interactioni

Protein-protein interaction databases

BioGridi139851, 1 interactor
STRINGi9615.ENSCAFP00000001437

Structurei

3D structure databases

ProteinModelPortaliQ29471
SMRiQ29471
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati23 – 83Annexin 1Add BLAST61
Repeati95 – 155Annexin 2Add BLAST61
Repeati179 – 239Annexin 3Add BLAST61
Repeati254 – 314Annexin 4Add BLAST61

Domaini

A pair of annexin repeats may form one binding site for calcium and phospholipid.

Sequence similaritiesi

Belongs to the annexin family.Curated

Keywords - Domaini

Annexin, Repeat

Phylogenomic databases

eggNOGiKOG0819 Eukaryota
ENOG410XPUN LUCA
GeneTreeiENSGT00760000118972
HOGENOMiHOG000158803
HOVERGENiHBG061815
InParanoidiQ29471
KOiK17099
OMAiFQAYQIL
OrthoDBiEOG091G0H6H
TreeFamiTF105452

Family and domain databases

Gene3Di1.10.220.10, 4 hits
InterProiView protein in InterPro
IPR001464 Annexin
IPR018502 Annexin_repeat
IPR018252 Annexin_repeat_CS
IPR037104 Annexin_sf
IPR009166 ANX13
PfamiView protein in Pfam
PF00191 Annexin, 4 hits
PRINTSiPR00196 ANNEXIN
PR01811 ANNEXINXIII
SMARTiView protein in SMART
SM00335 ANX, 4 hits
PROSITEiView protein in PROSITE
PS00223 ANNEXIN, 3 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q29471-1) [UniParc]FASTAAdd to basket
Also known as: Anx13A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNRHAKAKS HHGFDVDHDA KKLNKACKGM GTDEAAIIEI LSSRTSDERQ
60 70 80 90 100
QIKQKYKATY GKDLEEVFKS DLSGNFEKTA LALLDRPSEY DARQLQKAMK
110 120 130 140 150
GLGTDEAVLI EILCTRTNKE IMAIKEAYQR LFDRSLESDV KADTSGNLKA
160 170 180 190 200
ILVSLLQANR DEGDDVDKDL AGQDAKDLYD AGDGRWGTDE LAFNEVLAKR
210 220 230 240 250
SHKQLRATFQ AYQILIDKDI EEAIEAETSG DLQKAYLTLV RCARDQEGYF
260 270 280 290 300
ADRLYKSMKG TGTDEETLIH IIVTRAEVDL QGIKAKFQEK YQKSLSDMVR
310
SDTSGDFQKL LVALLH
Length:316
Mass (Da):35,479
Last modified:January 23, 2007 - v2
Checksum:iFD0B34AE0B6C8441
GO
Isoform B (identifier: Q29471-2) [UniParc]FASTAAdd to basket
Also known as: Anx13B

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: H → HSQSYSLSEGSQQLPKGDIQPSAAVQPLSHPSGSGEPEAQQP

Show »
Length:357
Mass (Da):39,666
Checksum:i6096AE08D2655EDA
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0002905H → HSQSYSLSEGSQQLPKGDIQ PSAAVQPLSHPSGSGEPEAQ QP in isoform B. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X80208 mRNA Translation: CAA56506.1
X80209 mRNA Translation: CAA56507.1
PIRiA57076
B57076
RefSeqiNP_001003255.1, NM_001003255.1 [Q29471-2]
XP_005627863.1, XM_005627806.1 [Q29471-1]
UniGeneiCfa.3796

Genome annotation databases

EnsembliENSCAFT00000001562; ENSCAFP00000001437; ENSCAFG00000001015 [Q29471-2]
GeneIDi403935
KEGGicfa:403935

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiANX13_CANLF
AccessioniPrimary (citable) accession number: Q29471
Secondary accession number(s): Q29472
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: March 28, 2018
This is version 127 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health