Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily C member 5

Gene

DNAJC5

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a general chaperone in regulated exocytosis (PubMed:9395474). Acts as a co-chaperone for the SNARE protein SNAP-25 (By similarity). Involved in the calcium-mediated control of a late stage of exocytosis (By similarity). May have an important role in presynaptic function. May be involved in calcium-dependent neurotransmitter release at nerve endings (By similarity).By similarity1 Publication

GO - Biological processi

Keywordsi

Molecular functionChaperone

Enzyme and pathway databases

ReactomeiR-BTA-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily C member 5By similarity
Alternative name(s):
Cysteine string protein1 Publication
Short name:
CSP1 Publication
Gene namesi
Name:DNAJC5By similarity
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 13

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi43H → Q: Decreased binding to HSC70. Loss of binding to HSC70; when associated with A-45. 1 Publication1
Mutagenesisi45D → A: Decreased binding to HSC70. Loss of binding to HSC70; when associated with Q-43. 1 Publication1
Mutagenesisi175P → A: Inhibits interaction with ZDHHC13 and ZDHHC17. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710511 – 198DnaJ homolog subfamily C member 5Add BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphoserineBy similarity1
Modified residuei10Phosphoserine1 Publication1
Modified residuei12PhosphoserineBy similarity1
Modified residuei15PhosphoserineBy similarity1
Modified residuei17PhosphotyrosineBy similarity1
Modified residuei56N6-acetyllysineBy similarity1
Modified residuei151PhosphoserineBy similarity1

Post-translational modificationi

Ser-10 phosphorylation induces an order-to-disorder transition triggering the interaction with Lys-58 (By similarity). This conformational switch modulates DNAJC5's cellular functions by reducing binding to syntaxin and synaptogamin without altering HSC70 interactions (By similarity).By similarity
Fatty acylated. Heavily palmitoylated in the cysteine string motif.By similarity

Keywords - PTMi

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ29455
PRIDEiQ29455

PTM databases

iPTMnetiQ29455
SwissPalmiQ29455

Expressioni

Gene expression databases

BgeeiENSBTAG00000015796

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with the chaperone complex consisting of HSC70 and SGTA (By similarity). Interacts with ZDHHC13 (via ANK repeats) (PubMed:26198635). Interacts with ZDHHC17 (via ANK repeats) (PubMed:26198635). Interacts with HSC70 (PubMed:9395474). Interacts with SYT1, SYT5 and SYT7, and with SYT9, forming a complex with SNAP25 (By similarity).By similarity2 Publications

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000039130

Structurei

3D structure databases

ProteinModelPortaliQ29455
SMRiQ29455
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini13 – 82JPROSITE-ProRule annotationAdd BLAST70

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi43 – 45Required for binding to Hsc701 Publication3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi118 – 128Poly-CysAdd BLAST11

Phylogenomic databases

eggNOGiKOG0716 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00920000148989
HOGENOMiHOG000231969
HOVERGENiHBG005414
InParanoidiQ29455
KOiK09525
OMAiGHYSYHT
OrthoDBiEOG091G0QJP
TreeFamiTF105164

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR018253 DnaJ_domain_CS
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS00636 DNAJ_1, 1 hit
PS50076 DNAJ_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform CSP1 (identifier: Q29455-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADQRQRSLS TSGESLYHVL GLDKNATSDD IKKSYRKLAL KYHPDKNPDN
60 70 80 90 100
PEAADKFKEI NNAHAILTDA TKRNIYDKYG SLGLYVAEQF GEENVNTYFV
110 120 130 140 150
LSSWWAKALF IFCGLLTCCY CCCCLCCCFN CCCGKCKPKA PEGEETEFYV
160 170 180 190
SPEDLEAQLQ SDEREAADTP IVIQPASATE TTQLTADSHP SYHTDGFN
Length:198
Mass (Da):22,133
Last modified:November 1, 1996 - v1
Checksum:i9A3D139FF5428A27
GO
Isoform CSP2 (identifier: Q29455-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-198: EAADTPIVIQPASATETTQLTADSHPSYHTDGFN → GGH

Show »
Length:167
Mass (Da):18,815
Checksum:i49911AD16D012AC0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001291165 – 198EAADT…TDGFN → GGH in isoform CSP2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92666 mRNA Translation: CAA63354.1
X92667 mRNA Translation: CAA63355.1
BC120234 mRNA Translation: AAI20235.1
RefSeqiNP_776958.2, NM_174533.4 [Q29455-1]
XP_010809668.1, XM_010811366.2 [Q29455-1]
UniGeneiBt.105070

Genome annotation databases

EnsembliENSBTAT00000035700; ENSBTAP00000035570; ENSBTAG00000015796 [Q29455-2]
ENSBTAT00000039334; ENSBTAP00000039130; ENSBTAG00000015796 [Q29455-1]
GeneIDi282216
KEGGibta:282216

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDNJC5_BOVIN
AccessioniPrimary (citable) accession number: Q29455
Secondary accession number(s): Q0VCC7, Q29456
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: June 20, 2018
This is version 145 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health