Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily C member 5

Gene

DNAJC5

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May have an important role in presynaptic function. May be involved in calcium-dependent neurotransmitter release at nerve endings.

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Enzyme and pathway databases

ReactomeiR-BTA-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily C member 5By similarity
Alternative name(s):
Cysteine string protein1 Publication
Short name:
CSP1 Publication
Gene namesi
Name:DNAJC5By similarity
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 13

Subcellular locationi

  • Membrane By similarity; Lipid-anchor By similarity
  • Melanosome By similarity
  • Cell membrane By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi175P → A: Inhibits interaction with ZDHHC13 and ZDHHC17. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710511 – 198DnaJ homolog subfamily C member 5Add BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphoserineBy similarity1
Modified residuei10PhosphoserineBy similarity1
Modified residuei12PhosphoserineBy similarity1
Modified residuei15PhosphoserineBy similarity1
Modified residuei17PhosphotyrosineBy similarity1
Modified residuei56N6-acetyllysineBy similarity1
Modified residuei151PhosphoserineBy similarity1

Post-translational modificationi

Fatty acylated. Heavily palmitoylated in the cysteine string motif (By similarity).By similarity

Keywords - PTMi

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ29455.
PRIDEiQ29455.

PTM databases

SwissPalmiQ29455.

Expressioni

Gene expression databases

BgeeiENSBTAG00000015796.

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with the chaperone complex consisting of HSC70 and SGTA (By similarity). Interacts with ZDHHC13 (via ANK repeats) (PubMed:26198635). Interacts with ZDHHC17 (via ANK repeats) (PubMed:26198635).By similarity1 Publication

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000039130.

Structurei

3D structure databases

ProteinModelPortaliQ29455.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini13 – 82JPROSITE-ProRule annotationAdd BLAST70

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi118 – 128Poly-CysAdd BLAST11

Sequence similaritiesi

Contains 1 J domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0716. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00760000118947.
HOGENOMiHOG000231969.
HOVERGENiHBG005414.
InParanoidiQ29455.
KOiK09525.
OMAiCGRCKPR.
OrthoDBiEOG091G0QJP.
TreeFamiTF105164.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform CSP1 (identifier: Q29455-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADQRQRSLS TSGESLYHVL GLDKNATSDD IKKSYRKLAL KYHPDKNPDN
60 70 80 90 100
PEAADKFKEI NNAHAILTDA TKRNIYDKYG SLGLYVAEQF GEENVNTYFV
110 120 130 140 150
LSSWWAKALF IFCGLLTCCY CCCCLCCCFN CCCGKCKPKA PEGEETEFYV
160 170 180 190
SPEDLEAQLQ SDEREAADTP IVIQPASATE TTQLTADSHP SYHTDGFN
Length:198
Mass (Da):22,133
Last modified:November 1, 1996 - v1
Checksum:i9A3D139FF5428A27
GO
Isoform CSP2 (identifier: Q29455-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-198: EAADTPIVIQPASATETTQLTADSHPSYHTDGFN → GGH

Show »
Length:167
Mass (Da):18,815
Checksum:i49911AD16D012AC0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001291165 – 198EAADT…TDGFN → GGH in isoform CSP2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92666 mRNA. Translation: CAA63354.1.
X92667 mRNA. Translation: CAA63355.1.
BC120234 mRNA. Translation: AAI20235.1.
RefSeqiNP_776958.2. NM_174533.4. [Q29455-1]
XP_010809668.1. XM_010811366.2. [Q29455-1]
UniGeneiBt.105070.

Genome annotation databases

EnsembliENSBTAT00000035700; ENSBTAP00000035570; ENSBTAG00000015796. [Q29455-2]
ENSBTAT00000039334; ENSBTAP00000039130; ENSBTAG00000015796. [Q29455-1]
GeneIDi282216.
KEGGibta:282216.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92666 mRNA. Translation: CAA63354.1.
X92667 mRNA. Translation: CAA63355.1.
BC120234 mRNA. Translation: AAI20235.1.
RefSeqiNP_776958.2. NM_174533.4. [Q29455-1]
XP_010809668.1. XM_010811366.2. [Q29455-1]
UniGeneiBt.105070.

3D structure databases

ProteinModelPortaliQ29455.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000039130.

PTM databases

SwissPalmiQ29455.

Proteomic databases

PaxDbiQ29455.
PRIDEiQ29455.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000035700; ENSBTAP00000035570; ENSBTAG00000015796. [Q29455-2]
ENSBTAT00000039334; ENSBTAP00000039130; ENSBTAG00000015796. [Q29455-1]
GeneIDi282216.
KEGGibta:282216.

Organism-specific databases

CTDi80331.

Phylogenomic databases

eggNOGiKOG0716. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00760000118947.
HOGENOMiHOG000231969.
HOVERGENiHBG005414.
InParanoidiQ29455.
KOiK09525.
OMAiCGRCKPR.
OrthoDBiEOG091G0QJP.
TreeFamiTF105164.

Enzyme and pathway databases

ReactomeiR-BTA-6798695. Neutrophil degranulation.

Gene expression databases

BgeeiENSBTAG00000015796.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDNJC5_BOVIN
AccessioniPrimary (citable) accession number: Q29455
Secondary accession number(s): Q0VCC7, Q29456
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.